/var/lib/rpm
NameSizeModeActions
.dbenv.lock00644editdlrm
.rpm.lock00644editdlrm
Basenames84459520644editdlrm
Conflictname163840644editdlrm
Dirnames29818880644editdlrm
Enhancename81920644editdlrm
Filetriggername81920644editdlrm
Group450560644editdlrm
Installtid409600644editdlrm
Name1433600644editdlrm
Obsoletename368640644editdlrm
Packages888750080644editdlrm
Providename23470080644editdlrm
Recommendname81920644editdlrm
Requirename5283840644editdlrm
Sha1header2662400644editdlrm
Sigmd51515520644editdlrm
Suggestname81920644editdlrm
Supplementname81920644editdlrm
Transfiletriggername81920644editdlrm
Triggername81920644editdlrm
__db.0013112960644editdlrm
__db.002901120644editdlrm
__db.00313189120644editdlrm
Edit: /var/lib/rpm/__db.003 (1318912B)
[:{7Z:A 0hP. L5Qw\Z:Sk:@* LX!p!8!8!8p88  P6 H))H]` P`Pp  8 x>x!0 w"N8V#$ %h e&spK 'H(p()*(+X_,-.yP^/xa0Q *1 2+x 3a H4X 58mp6 7' 8 9PVP:8}; x<0f=0 >GP ?h0@6xAB(CP@Dx ECCFGH~ I XHJ: :K LM8 P NOPQ0 H R T8TS%T[?UVWXYZ@X[0\з]0H^(_x8`` G a(bs@c ( dp e g f`#o g % hixjmHkXC lm no)*pqrstruuvH`wZ Z x( p) yzJ {X|H  }XhZ ~'  OO`` x>ȺTh0XpzPHB`B)h xhhf  -WWxt hE 0xHxu x e 8e (xxHXH5TTT`&@ %9=:=:9 & &HH \V@@@ Packages@@ X L8 $com> - 2.8-11.1Petr Lautrbach - 2.8-10Petr Lautrbach - 2.8-9Petr Lautrbach - 2.8-8Petr Lautrbach - 2.8-7Petr Lautrbach - 2.8-6.1Petr Lautrbach - 2.8-5Petr Lautrbach - 2.8-4Petr Lautrbach - 2.8-3Petr Lautrbach - 2.8-2Petr Lautrbach - 2.8-1.1Petr Lautrbach - 2.7-19Petr Lautrbach - 2.7-18Petr Lautrbach - 2.7-17Petr Lautrbach - 2.7-16Petr Lautrbach - 2.7-15Petr Lautrbach - 2.7-14Petr Lautrbach - 2.7-13Miro Hrončok - 2.7-12Petr Lautrbach - 2.7-11Fedora Release Engineering - 2.7-10Petr Lautrbach - 2.7-9Igor Gnatenko - 2.7-8Petr Lautrbach - 2.7-7Petr Lautrbach - 2.7-6Petr Lautrbach - 2.7-5Petr Lautrbach - 2.7-4Zbigniew Jędrzejewski-Szmek - 2.7-3Zbigniew Jędrzejewski-Szmek - 2.7-2Petr Lautrbach - 2.7-1Fedora Release Engineering - 2.6-9Florian Weimer - 2.6-8Petr Lautrbach - 2.6-7Fedora Release Engineering - 2.6-6Petr Lautrbach - 2.6-5Petr Lautrbach - 2.6-4Petr Lautrbach - 2.6-3Petr Lautrbach - 2.6-2Petr Lautrbach - 2.6-1.1Igor Gnatenko - 2.5-22Fedora Release Engineering - 2.5-21Kevin Fenzi - 2.5-20Petr Lautrbach - 2.5-19Petr Lautrbach - 2.5-18Petr Lautrbach 2.5-17Petr Lautrbach 2.5-16Petr Lautrbach 2.5-15Richard W.M. Jones - 2.5-14Fedora Release Engineering - 2.5-13Petr Lautrbach - 2.5-12Petr Lautrbach - 2.5-11Petr Lautrbach - 2.5-10Petr Lautrbach - 2.5-9Petr Lautrbach - 2.5-8Petr Lautrbach - 2.5-7Petr Lautrbach - 2.5-6Petr Lautrbach - 2.5-5Petr Lautrbach - 2.5-4Petr Lautrbach - 2.5-3Petr Lautrbach 2.5-2Petr Lautrbach 2.5-1Fedora Release Engineering - 2.4-21Petr Lautrbach - 2.4-20Petr Lautrbach 2.4-19Petr Lautrbach 2.4-18Fedora Release Engineering - 2.4-17Petr Lautrbach 2.4-16Robert Kuska - 2.4-15Petr Lautrbach 2.4-14Petr Lautrbach 2.4-13Petr Lautrbach 2.4-12Petr Lautrbach 2.4-11Petr Lautrbach 2.4-10Petr Lautrbach 2.4-9Petr Lautrbach 2.4-8Petr Lautrbach 2.4-7Petr Lautrbach 2.4-6Petr Lautrbach 2.4-5Petr Lautrbach 2.4-4Petr Lautrbach 2.4-3Petr Lautrbach 2.4-2Petr Lautrbach 2.4-1.1Petr Lautrbach 2.4-0.7Petr Lautrbach 2.4-0.6Fedora Release Engineering - 2.3-18Petr Lautrbach 2.3-17Petr Lautrbach 2.4-0.4Pexx"""8 8  H \M9TxxxName@p@0X}Lo @$e modules. (Ales Kozumplik) - tests: refactor: make Term tests more isolated. (Radek Holy) - tests: fix terminfo capability independence. (Radek Holy) - api: explain that Base is a context manager with a close(). (Ales Kozumplik) - cosmetic: move stuff around in comps. (Ales Kozumplik) - api: groups: add comps.Package, add group.package_iter(). (RhBug:1079932) (Ales Kozumplik) - fixed installation of conflicted packages (RhBug:1061780) (Jan Silhan) - removed never executed code based on _ts_saved_file variable (Jan Silhan) - added logrotate script and ownership of log files to dnf (RhBug:1064211) (Jan Silhan) - fixed: highlight characters broken under py3 (RhBug:1076884) (Jan Silhan) - remove: base.deselectGroup(). it is not used. (Ales Kozumplik) - tests: fix broken InstallMultilib.test_install_src_fails(). (Ales Kozumplik) - groups: support manipulation with environments (RhBug:1063666) (Ales Kozumplik) - add dnf.util.partition(). (Ales Kozumplik) - refactor: RepoPersistor: use the global logger instead of an instance variable. (Ales Kozumplik) - groups: besides installed groups also store persistently the environments. (Ales Kozumplik) - rename: persistor.Groups -> ClonableDict. (Ales Kozumplik) - doc: cli_vs_yum: typography in bandwidth limiting section. (Ales Kozumplik) - doc: cli_vs_yum: we do not partially allow operations that install .srpm. (RhBug:1080489) (Ales Kozumplik) - refactor: imports order in cli/commands/__init__.py. (Ales Kozumplik) - refactor: groups: make all commands use _patterns2groups(). (Ales Kozumplik) - kernel: remove kernel-source from const.INSTALLONLYPKGS. (Ales Kozumplik) - build: 0.4.19-1 (Ales Kozumplik) - New version: 0.4.19 (Ales Kozumplik) - downloads: bump number of downloaded files on a skip. (RhBug:1079621) (Ales Kozumplik) - packaging: add dnf.cli.commands to the installation. (Ales Kozumplik) - refactor: put GroupCommand into its separate module. (Ales Kozumplik) - rename: make cli.commands a subpackage. (Ales Kozumplik) - AUTHORS: added Albert. (Ales Kozumplik) - test: fixed CacheTest.test_noroot() when running as root (Albert Uchytil) - AUTHORS: added Tim. (Ales Kozumplik) - fixes TypeError: '_DownloadErrors' object is not iterable (RhBug:1078832) (Tim Lauridsen) - fixed not including .mo files (Jan Silhan) - comps: _by_pattern() no longer does the comma splitting. (Ales Kozumplik)- downloads: bump number of downloaded files on a skip. (RhBug:1079621) (Ales Kozumplik) - packaging: add dnf.cli.commands to the installation. (Ales Kozumplik) - refactor: put GroupCommand into its separate module. (Ales Kozumplik) - rename: make cli.commands a subpackage. (Ales Kozumplik) - AUTHORS: added Albert. (Ales Kozumplik) - test: fixed CacheTest.test_noroot() when running as root (Albert Uchytil) - AUTHORS: added Tim. (Ales Kozumplik) - fixes TypeError: '_DownloadErrors' object is not iterable (RhBug:1078832) (Tim Lauridsen) - fixed not including .mo files (Jan Silhan) - comps: _by_pattern() no longer does the comma splitting. (Ales Kozumplik) - including .mo files correctly (Jan Silhan) - tests: fix locale independence. (Radek Holy) - remove: unused trashy methods in dnf.yum.misc. (Ales Kozumplik) - persistor: do not save Groups if it didn't change (RhBug:1077173) (Ales Kozumplik) - tests: simplify the traceback logging. (Ales Kozumplik) - main: log IO errors etc. thrown even during Base.__exit__. (Ales Kozumplik) - logging: do not log IOError tracebacks in verbose mode. (Ales Kozumplik) - refactor: move out main._main()'s inner error handlers. (Ales Kozumplik) - added gettext as a build dependency for translation files (Jan Silhan) - translation: updated .pot file and fetched fresh .po files from transifex (Jan Silhan) - removed redundant word from persistor translation (Jan Silhan) - translation: show relative path in generated pot file (Jan Silhan) - refactor: replaced type comparisons with isinstance (Jan Silhan) - translation: added mo files generation and including them in rpm package (Jan Silhan) - removed unused imports in base.py (Jan Silhan) - doc: typxXLp/j-$zj-i-k- 1.5.0.0-7Paul Wouters 1.5.0.0-6Paul Wouters 1.5.0.0-5Paul Wouters 1.5.0.0-4Paul Wouters 1.5.0.0-3Paul Wouters - 1.5.0.0-2Paul Wouters - 1.5.0.0-1Paul Wouters - 1.4.3.1-1Paul Wouters 1.4.3.0-2Paul Wouters 1.4.3.0-1- add fix for CVE-2024-54661 Resolves: RHEL-70095 - switch to autopatch, remove unused patches- Resolves: rhbz#1805132 socat does not recognize IP addresses of the SAN extensions in ssl mode - Resolves: rhbz#1870279 Transfer via socat fails with openssl enabled - Resolves: rhbz#1914989 Socat udp4-recvfrom cause endless loop error when target is not vaild- Resolves: rhbz#1682464 socat changes blocked until gating tests are added- Resolves: rhbz#1723581 socat-1.7.3.3 is available- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Resolves: rhbz#1518784 socat should not require tcp_wrappers- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Add BuildRequire for tcp_wrappers-devel to gain libwrap support- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Resolves rhbz#1404290 socat build failure on rawhide - Resolves rhbz#1416597 socat-1.7.3.2 is available - Resolves rhbz#1417483 Failed DNS resolution causes SIGSEGV and endless loop - Removed obsoleted patch- Rebuild for readline 7.x- Update to 1.7.3.1 (#1186301)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Resolves rhbz#1182005 - socat 1.7.2.4 build failure missing linux/errqueue.h- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Updated to 1.7.2.4 which contains many bugfixes - Run tests in make check - Add build dependancies for make test- Updated to 1.7.2.3 for CVE-2014-0019- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Added two patches that fixes some -Wformat warnings. these fix 2 of 3 failing test cases from test.sh - Enabled hardening with full relro/pie - Switch from readline5 to readline(6)- Updated to 1.7.2.2 for CVE-2013-3571, rhbz#967539- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Updated to 1.7.2.1 for CVE-2012-0219, rhbz#821553, rhbz#821688 - Remove patch merged upstream - Remove --disable-fips from configure- Upgraded to 1.7.2.0 which allows tun/tap interfaces without IP address and introduces options openssl-compress and max-children.- support TUN endpoint without IP address (rhbz#706226) [Till Maas]- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Upgrade to 1.7.1.3 - Includes fix for CVE-2010-2799 Stack overflow by lexical scanning of nested character patterns - Resolves https://bugzilla.redhat.com/show_bug.cgi?id=620430- Upgraded to 1.7.1.2 - Link against compat-readline5 for GPLv2 license (Miroslav Lichvar) (bz #511310)- recreate autoconf to get correct includes when determining type sizes in order to build correctly- Bump for new openssl- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Upgraded to 1.7.1.1. - Patch for configure.in with -Wall- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Updated to new upstream version - utf8 the CHANGES file- disable the upstream openssl fips support- forgot to upload new source- fix license tag - update to 1.6.0.1- Autorebuild for GCC 4.3- Rebuild for deps- Rebuild for updatesd libcrypto- Tagging failure bug in redhat build system requires bump- Some filesystem defines moved from their specific (ext2) filesystem defines into the generic .- Rebuild requested for PT_GNU_HASH support from gcc- Added missing examples to doc x XTL,% T$PTTTirewalld service file (RHBZ#806868) and (RHBZ#811240) - Fixed duplicates in zone after reload, enabled timed settings after reload - Removed conntrack --ctstate INVALID check from default ruleset, because it results in ICMP problems (RHBZ#806017). - Update interfaces in default zone after reload (rhbz#804814) - New man pages for firewalld(1), firewalld.conf(5), firewalld.icmptype(5), firewalld.service(5) and firewalld.zone(5), updated firewall-cmd man page (RHBZ#811257) - Fixed firewall-cmd help output - Fixed missing icon for firewall-applet (RHBZ#808759) - Added root user check for firewalld (RHBZ#767654) - Fixed requirements of firewall-applet sub package (RHBZ#808746) - Update interfaces in default zone after changing of default zone (RHBZ#804814) - Start firewalld before NetworkManager (RHBZ#811240) - Add Type=dbus and BusName to service file (RHBZ#811240)- fixed firewalld.conf save exception if no temporary file can be written to /etc/firewalld/- firewall-cmd: several changes and fixes - code cleanup - fixed icmp protocol used for ipv6 (rhbz#801182) - added and fixed some comments - properly restore zone settings, timeout is always set, check for 0 - some FirewallError exceptions were actually not raised - do not REJECT in each zone - removeInterface() don't require zone - new tests in firewall-test script - dbus_to_python() was ignoring certain values - added functions for the direct interface: chains, rules, passthrough - fixed inconsistent data after reload - some fixes for the direct interface: priority positions are bound to ipv, table and chain - added support for direct interface in firewall-cmd: - added isImmutable(zone) to zone D-Bus interface - renamed policy file - enhancements for error messages, enables output for direct.passthrough - added allow_any to firewald policies, using at leas auth_admin for policies - replaced ENABLE_FAILED, DISABLE_FAILED, ADD_FAILED and REMOVE_FAILED by COMMAND_FAILED, resorted error codes - new firewalld configuration setting CleanupOnExit - enabled polkit again, found a fix for property problem with slip.dbus.service - added dhcpv6-client to 'public' (the default) and to 'internal' zones. - fixed missing settings form zone config files in "firewall-cmd --list=all --zone=" call - added list functions for services and icmptypes, added --list=services and --list=icmptypes to firewall-cmd- enabled dhcpv6-client service for zones home and work - new dhcpv6-client service - firewall-cmd: query mode returns reversed values - new zone.changeZone(zone, interface) - moved zones, services and icmptypes to /usr/lib/firewalld, can be overloaded by files in /etc/firewalld (no overload of immutable zones block, drop, trusted) - reset MinimalMark in firewalld.cnf to default value - fixed service destination (addresses not used) - fix xmlplus to be compatible with the python xml sax parser and python 3 by adding __contains__ to xml.sax.xmlreader.AttributesImpl - use icon and glib related post, postun and posttrans scriptes for firewall - firewall-cmd: fix typo in state - firewall-cmd: fix usage() - firewall-cmd: fix interface action description in usage() - client.py: fix definition of queryInterface() - client.py: fix typo in getInterfaces() - firewalld.service: do not fork - firewall-cmd: fix bug in --list=port and --port action help message - firewall-cmd: fix bug in --list=service- moved zones, services and icmptypes to /usr/lib/firewalld, can be overloaded by files in /etc/firewalld (no overload of immutable zones block, drop, trusted)- added missing firewall.dbus_utils- added glib2-devel to build requires, needed for gsettings.m4 - added --with-system-unitdir arg to fix installaiton of system file - added glib-compile-schemas calls for postun and posttrans - added EXTRA_DIST file lists- version 0.2.0 with new FirewallD1 D-BUS interface - supports zones with a default zone - new direct interface as a replacement of the partial virt interface with additional passthrough functionality - dropped custom rules, use direcxXyL$han) - refactor: put CleanCommand in its own module. (Ales Kozumplik) - cli: avoid 'Error: None' output on malformed CLI commands. (Ales Kozumplik) - remove the special SIGQUIT handler. (Ales Kozumplik) - api: In Repo(), cachedir is a required argument. (Ales Kozumplik) - api: better describe how Repos should be created, example. (RhBug:1117789) (Ales Kozumplik) - Base._conf lasts the lifetime of Base and can be passed via constructor. (Ales Kozumplik) - doc: faq: having Yum and DNF installed at the same time. (Ales Kozumplik) - remove: protected_packages config option, it has been ignored. (Ales Kozumplik) - fix: misleading error message when no repo is enabled. (Ales Kozumplik)- pkg name from rpm transaction callback is in Unicode (RhBug:1118796) (Jan Silhan) - packaging: python3-dnf depends on dnf. (RhBug:1119032) (Ales Kozumplik) - Ship /usr/bin/dnf-3 to run DNF under Py3. (RhBug:1117678) (Ales Kozumplik) - packaging: own /etc/dnf/plugins. (RhBug:1118178) (Ales Kozumplik) - fix: pluginconfpath is a list. (Ales Kozumplik) - cosmetic: use classmethod as a decorator in config.py. (Ales Kozumplik) - cleanup: imports in dnf.cli.output (Ales Kozumplik) - lint: straightforward lint fixes in dnf.cli.output. (Ales Kozumplik) - Repo.__setattr__ has to use the parsed value. (Ales Kozumplik) - Repo priorities. (RhBug:1048973) (Ales Kozumplik) - repo: simplify how things are propagated to repo.hawkey_repo. (Ales Kozumplik) - refactor: concentrate Repo.hawkey_repo construction in Repo.__init__(). (Ales Kozumplik) - bash-completion: Update command and option lists, sort in same order as --help (Ville Skyttä) - bash-completion: Use grep -E instead of deprecated egrep (Ville Skyttä) - output: fixed identation of info command output (Jan Silhan) - i18n: calculates right width of asian utf-8 strings (RhBug:1116544) (Jan Silhan) - transifex update + renamed po files to Fedora conventions (Jan Silhan) - remove: CLI: --randomwait (Ales Kozumplik) - cli: fix: --installroot has to be used with --releasever (RhBug:1117293) (Ales Kozumplik) - Base.reset(goal=True) also resets the group persistor (RhBug:1116839) (Ales Kozumplik) - tests: fix failing DistroSync.test_distro_sync(). (Ales Kozumplik) - logging: RPM transaction markers are too loud. (Ales Kozumplik) - logging: silence drpm a bit. (Ales Kozumplik) - logging: put timing functionality into one place. (Ales Kozumplik) - repolist: fix traceback with disabled repos. (RhBug:1116845) (Ales Kozumplik) - refactor: cleanups in repolist. (Ales Kozumplik) - lint: remove some unused imports. (Ales Kozumplik) - cli: break out the repolsit command into a separate module. (Ales Kozumplik) - does not crash with non-ascii user name (RhBug:1108908) (Jan Silhan) - doc: document 'pluginpath' configuration option. (RhBug:1117102) (Ales Kozumplik) - Spelling fixes (Ville Skyttä) - cli: Fix software name in --version help (Ville Skyttä) - doc: ip_resolve documented at two places. remove one. (Ales Kozumplik)- packaging: bump hawkey dep to 0.4.17. (Ales Kozumplik) - api: remove Base.select_group(). (Ales Kozumplik) - tests: cleanup our base test case classes a bit. (Ales Kozumplik) - Add DNF itself among the protected packages. (Ales Kozumplik) - api: plugins: add the resolved() hook. (Ales Kozumplik) - api: expose Transaction introspecting in the API. (RhBug:1067156) (Ales Kozumplik) - api: add basic documentation for dnf.package.Package. (Ales Kozumplik) - tests: cosmetic: conf.protected_packages is ignored, drop it in FakeConf. (Ales Kozumplik) - cli: simplify exception handling more. (Ales Kozumplik) - Fixed a minor typo in user_faq - 'intall' should be 'install' (Martin Preisler) - fixed encoding of parsed config line (RhBug:1110800) (Jan Silhan) - syntax: replaced tab with spaces (Jan Silhan) - doc: acknowledge the existence of plugins on the man page (RhBug:1112669) (Ales Kozumplik) - improve the 'got root?' message of why a transaction couldn't start. (RhBug:1111569) (Ales Kozumplik) - traceback in Base.do_transaction. to_utf8() is gone since 06fb280. (Ales Kozumplik)xXLȒ$  -c rather then -C for consistancy - Fix memory and fd leaks in seunshare- Introduce systemd unit file for restorecond drop SysV support- Do not drop capability bounding set in seunshare, this allows sandbox to - run setuid apps.- Add semanage-bash-completion.sh script- Remove mount -o bind calls from sandbox init script - pam_namespace now has this built in.- Pass desktop dpi to sandbox Xephyr window- Allow semodule to pick alternate root for selinux files - Add ~/.config/* to restorcond_user.conf, so restorecond will watch for mislabeled files in this directory.- Fix var_spool template read_spool_files - Fix sepolgen to handle filename transitions- Templates cleanedup by Dominic Grift- Clean up some of the templates for sepolgen- Apply patches from Christoph A. * fix sandbox title * stop xephyr from li - Also ignore errors on sandbox include of directory missing files- rebuild versus latest libsepol- Change fixfiles restore to delete unlabeled sockets in /tmp- rebuild versus latest libsepol- Update to upstream * Use correct color range in mcstrand by Richard Haines.- Add Elia Pinto patches to allow user to specify directories to ignore- Fix policycoreutils-sandbox description- rsynccmd should run outside of execcon- Fix semange node handling of ipv6 addresses- Fix sepolgen-ifgen call, add -p option- Fix sepolgen-ifgen call- Fix rsync command to work if the directory is old. - Fix all tests- Fix sepolgen to generate network polcy using generic_if and genric_node versus all_if and all_node- Return to original seunshare man page- change default location of HOMEDIR in sandbox to /tmp/.sandbox_home_* - This will allow default sandboxes to work on NFS homedirs without allowing access to homedir data- Change sepolgen-ifgen to search all available policy files - Exit in restorecond if it can not find a UID in the passwd database- Fix portspage in system-config-selinux to not crash - More fixes for seunshare from Tomas Hoger- put back in old handling of -T in sandbox command - Put back setsid in seunshare - Fix rsync to maintain times- Use rewritten seunshare from thoger- Require python-IPy for policycoreutils-python package - Fixes for sepologen - Usage statement needs -n name - Names with _ are being prevented - dbus apps should get _chat interface- Fix error message in seunshare, check for tmpdir existance before unlink.- Rewrite seunshare to make sure /tmp is mounted stickybit owned by root - Only allow names in polgengui that contain letters and numbers - Fix up node handling in semanage command - Update translations- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Fix sandbox policy creation with udp connect ports- Cleaup selinux-polgengui to be a little more modern, fix comments and use selected name - Cleanup chcat man page- Report full errors on OSError on Sandbox- Fix newrole hanlding of pcap- Have restorecond watch more directories in homedir- Add sandbox to sepolgen- Fix proper handling of getopt errors - Do not allow modules names to contain spaces- Polgengui raises the wrong type of exception. #471078 - Change semanage to not allow it to semanage module -D - Change setsebool to suggest run as root on failure- Fix restorecond watching utmp file for people logging in our out- Update to upstream- Change to allow sandbox to run on nfs homedirs, add start python script- Move seunshare to sandbox package- Fix sandbox to show correct types in usage statement- Stop fixfiles from complaining about missing dirs- Update to upstream - List types available for sandbox in usage statement- Don't report error on load_policy when system is disabled.- Fix up problems pointed out by solar designer on dropping capabilities- Check if you have full privs and reset otherwise dont drop caps- Fix setools require line- Move /etc/pam.d/newrole in to polcicycoreutils-newrole - Additional capability checking in sepolgen- Remove setuid flag and replace with file capabilities - Fix sandbox handling of files with spaces in themxxtX L@]D$M]D\D^D^C%^C$]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C$]w]w]w]w]w^C$]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C$]w]w]w]w]w]w]w]w]w]w^C$]w]w]w]w^C$]w]w]w]w]w]w]w]w]w]w^C$]w]w]w]w]w]w]w^C%]w^C$]w^C$]w^C$]w^C$]w]w]w]w^C%^C%^C%^C%]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C%]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C%]w]w]w]w]w]w]w]w^C%]w]w]w]w]w]w]w]w]w]w]w]w^C%]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C%]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C%]w]w]w]w^C%]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C%]w^C%]w]w]w]w]w]w]w]w]w^C%]w]w^C%]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C%]w]w]w^C%]w]w]w]w]w]w]w]w]w]w]w]w]w^C&]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^C$ab88a02b01ce646a5a3965a05f1876b70b97b24e4d6409973126a0baa59126a5e7f0630dbf09f3bb3adf3bb8e8d2464afbd6e616fe0075dbef29b7e82bd2a50daebbf3da932436bd2d92507fac0940f83106c6fcd7886dedefa246dede61f747d001767068fe2791a48f829153820a8717f659e08c9a061759cd66e9e37a383311d1fd1f5364ef778eb0edc36b4f1955ca165c1900703f163c1406aa8ae767cdd57bb7e152d9a10de56bd0e22a72eac7787ea8c4319fe2b7a8d632aea1a67f8233b37cb2a14007d745d884b1d2572e9a307b59d12319bad0e494307fd7a9be897d3882ccecb24b1621975fde25fc7e90e5c1c00197cf67820622458f35bb34ae24c54410578e535f6284801c3f1bd342203eb766836bec18b3d40646d165f33d4deb4eb4390d48791e27840e564b4c0737598252101063dc0a5b5471b7968da5f81b1dd7ea373290245651419b61bac751b065ecf89c8f65e18151a5b6af5f2652452b357384d7f06f5bc0a03ece55e633104d8aae970bcd3492105c579a28f8805f42ae3a6ff3c0152879205f5bf6cf46d2ba8cc53529ef2a21d481840a9714dcdd34a1aca546dba1c72da30586bfbb0cbce689f4abad3e594f9872a5f932c299e7e42d639ca932ebb953fa0914b68dd04302e008652b7cee579e6c1a4cd478b26b48de85d159629fa18b9fe5831092309b9631b860561c04fbda7c70c54123ade96d0e9fa4427c48e50ec708407bbd94c1bf4560fd05581391647e5f9ee9bbaf9547fba4003f85913471de89e4d497cd8504ae90a14909816285ab17c2a199f0d444a24488ccc5e905ff5fc0e8190a613c3938851cb14641660c466a98329730c221ba7eaddcb16c5ca7f982a521e552f901adf06002e387f48c301060b751b43af41ae3f50342760c8d7f6a2e53c10b6c04f47cd5f7693cd579b16cbe0395644bd4df8c9a816a871ff5acd5cf47bbccc3a6727b6838d4b22c78d3aa2c2b5115f5476f05ab289dd3cd2cc44d9786a011bf7754a400af8e1c7c678de621167c426427361388fc73a8094fda2cf591e1ae1674332a6acaef62be1ea293e460e285de5df45bfd20e6a41e2d08d7eee56c1b6b5acc75f97e261432284c5a8ed77cd0fc8e398b613067ecc1880cf2e48f88d476705ee679044044acba10d6162e27287bcaaeca49daf5a18fcfd913e3f271fbef2c4327b860c145e8507e5fa45f4d6127f0cfa9cac59b79900d21ac116b8f6708b4bb57812137b511275a7bf65614ca45ee77b81111e721b8f05c4eaec3838b85f1083494a191818bb4ea3f9d5dd0da21977d91df78344906167dba287adbdff60339c48254ad3f71dfb4cae8e212077238e18a2a33ac71b10fbca54f6ab8e60d58d9ec96a0bfa23e8eabee711956f59a35cf325f9df41959249385c51b93aa207dfbc1c2529f0f50c3ff43c05a1863850244702ea392f679e20b2765402936e38fb47e65ec445c7ff8ad2ab37348b5f943d1cbdb478778bc86ee42db6fc01e29a9ccaa12888628b8c9f749527a2e5f9154xcXL,;$;;;n Dahyabhai 3.19-1Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Preston Brown Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Matt Wilson Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Florian La Roche Florian La Roche Bernhard Rosenkraenzer Damien Miller Damien Miller Damien Miller - Speed up loading client CA list from CAfile Resolves: RHEL-46411 - Do not load all CAs in client mode to allow continued use of BEGIN TRUSTED CERTIFICATE format Resolves: RHEL-50154- Restore support for the NO_TLSv1.[123] values for the option directive Resolves: RHEL-2340- New upstream release 5.71 Resolves: RHEL-2340 - Enable socket activation support - verify upstream source in %prep - clean up stale conditionals- Fixes CVE-2021-20230 stunnel: client certificate not correctly verified when redirect and verifyChain options are used.- Updates documentation to specify that the option "curves" can be used in server mode only.- Fixes default tls version patch to handle default values from OpenSSL crypto policies- Adds default tls version patch to comply with OpenSSL crypto policies- New upstream release 5.56- Fix -fstack-protector-strong build flag application - Fix bugs from Coverity scan- Override system crypto policy for build tests- Drop 042_inetd test which fails in the build environment- New upstream release 5.48- New upstream release 5.46- Fix bind to localhost (patch backport by Christian Kujau) (#1542361)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Fix systemd executions/requirements- Make the disablement of libwrap conditional- New upstream release 5.44 - Disable libwrap support (#1518789)- New upstream release 5.42 - Use the system cipher list by default (#1483967)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- New upstream release 5.41- New upstream release 5.40 - Properly mark license files - Rebase patches - Eliminate unnecessary Provides - Small spec cleanups and fixes- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- New upstream release 5.35 with fix for bug #1358810- New upstream release 5.34- New upstream release 5.30 - Add generic stunnel@.service provided by Štefan Gurský (#1195742)- New upstream release 5.18. - Finally deleted the patch stunnel-5-sample.patch as upstream has merged those changes. - Fixes patches as per new code changes. - Fixed systemd service file related changes.- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- New upstream release 5.17.- New upstream release 5.16.- New upstream release 5.15. - 1155977: Fixed upstream too so removed the associated patch - Updates other patches too.- New upstream release 5.14.- New upstream release 5.13.- New upstream release 5.12.- New upstream release 5.11.- New upstream release 5.10.- 1163349: New upstream release 5.09.- 1163349: New upstream release 5.08- 1163349: New upstream beta release 5.08b6 - Fixed incorrect reporting of fips status in configure.ac at compile time, requires autoconf automake at buildtime - Fixed default OpenSSL directory issue by using with-ssl - Updates local patches - 1155977: Fixes man page issues- New upstream release 5.07- New upstream release 5.06 - Addresses Poodle security issue- rhbz #1144393: New upstream beta release - systemd socket activation support- Fixes packaging issues mentioned in rhbz#226439- New upstream realexXSXL xd$/semi raw mode for open_init_pty helper from Manoj Srivastava. * Rewrote setfiles to use matchpathcon and the new interfaces exported by libselinux (>= 1.21.5).- Fix fixfiles patch - Upgrade to latest from NSA * Prevent overflow of spec array in setfiles. - Add diff comparason between file_contexts to fixfiles - Allow restorecon to give an warning on file not found instead of exiting- Upgrade to latest from NSA * Merged newrole -l support from Darrel Goeddel (TCS). - Fix genhomedircon STARTING_UID- Upgrade to latest from NSA * Merged fixfiles patch for file_contexts.local from Dan Walsh.- Temp file needs to be created in /etc/selinux/POLICYTYPE/contexts/files/ directory.- Upgrade to latest from NSA * Fixed restorecon to not treat errors from is_context_customizable() as a customizable context. * Merged setfiles/restorecon patch to not reset user field unless -F option is specified from Dan Walsh. * Merged open_init_pty helper for run_init from Manoj Srivastava. * Merged audit2allow and genhomedircon man pages from Manoj Srivastava.- Don't change user componant if it is all that changed unless forced. - Change fixfiles to concatinate file_context.local for setfiles- Update to latest from NSA- Fix restorecon segfault- Update to latest from NSA * Merged fixfiles rewrite from Dan Walsh. * Merged restorecon patch from Dan Walsh.- Update to latest from NSA * Merged fixfiles and restorecon patches from Dan Walsh. * Don't display change if only user part changed.- Fix fixfiles handling of rpm - Fix restorecon to not warn on symlinks unless -v -v - Fix output of verbose to show old context as well as new context- Update to latest from NSA * Changed restorecon to ignore ENOENT errors from matchpathcon. * Merged nonls patch from Chris PeBenito.- Update to latest from NSA * Removed fixfiles.cron. * Merged run_init.8 patch from Dan Walsh.- Fix run_init.8 to refer to correct location of initrc_context- Upgrade to latest from NSA- Add code to sestatus to output the current policy from config file- Patch audit2allow to return self and no brackets if only one rule- Update to latest from NSA - Eliminate fixfiles.cron- Only run fixfiles.cron once a week, and eliminate null message- Update with NSA * Added -l option to setfiles to log changes via syslog. * Merged -e option to setfiles to exclude directories. * Merged -R option to restorecon for recursive descent.- Add -e (exclude directory) switch to setfiles - Add syslog to setfiles- Add -R (recursive) switch to restorecon.- Change to only display to terminal if tty is specified- Only display to stdout if logfile not specified- Add Steve Grubb patch to cleanup log files.- Add optargs - Update to match NSA- Add fix to get cdrom info from /proc/media in fixfiles.- Add Steve Grub patches for * Fix fixfiles.cron MAILTO * Several problems in sestatus- Add -q (quiet) qualifier to load_policy to not report warnings- Add requires for libsepol >= 1.1.1- Update to latest from upstream- Update to latest from upstream - Includes Colin patch for verifying file_contexts- Update to latest from upstream- Update to latest from upstream- Add Man page for load_policy- new version from NSA uses libsepol- Fix genhomedircon join command- Latest from NSA- Change fixfiles to not change when running a check- Fix restorecon getopt call to stop hang on IBM Arches- Only mail files less than 100 lines from fixfiles.cron - Add Russell's fix for genhomedircon- Latest from NSA- Add ro warnings- Latest from NSA - Fix fixfiles.cron to delete outfile- Fix fixfiles.cron to not run on non SELinux boxes - Fix several problems in fixfiles and fixfiles.cron- Update from NSA - Add cron capability to fixfiles- Update from NSA- Fix fixfiles to handle no rpm file on relabel- Update latest from NSA - Add -o option to setfiles to save output of any files with incorrexBXL`P1$!12D-,?)Hd   T 4@Z`h      (KnG(p8xS9S:SG%TH%pI%X%Y%\%]%^&b&d(e(f(l( t($u(@v(\(())D)X)\* +  ,,--- g-$h-(Cmailcap2.1.483.el8Helper application and MIME type associations for file typesThe mailcap file is used by the metamail program. Metamail reads the mailcap file to determine how it should display non-text or multimedia material. Basically, mailcap associates a particular type of file with a particular program that a mail agent or other program can call in order to handle the file. Mailcap should be installed to allow certain programs to be able to handle non-text files. Also included in this package is the mime.types file which contains a list of MIME types and their filename "extension" associations, used by several applications e.g. to determine MIME types for filenames.]build.cloudlinux.comCloudLinuxCloudLinuxPublic Domain and MITCloudLinux Packaging Team Unspecifiedhttps://pagure.io/mailcaplinuxnoarchV8A큤A큤Y`RY`R]Y`R]Y`RY`R9e701bfd119a566cd01950a1fa4049e3d0caf8cad684228ff04afb232aa911b84abf96380a36528f2ba411d028494dc4f985a78e81b3c0897a819fe399fc618457de3a933eafbb22526670f6252dbafcf9b5f5fdcc74c3be03bdb9c89e8af414b8c8d2325ff1c864889fbef64cc635dd15c509c3078dbb9dbc523b7c11f15aaa1cffa90d5d601beb7d716617d4097c2c0641d768aff05a4d9111f8838fd75ecarootrootrootrootrootrootrootrootrootrootrootrootrootrootmailcap-2.1.48-3.el8.src.rpmconfig(mailcap)mailcap    config(mailcap)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)2.1.48-3.el83.0.4-14.6.0-14.0-15.2-14.14.2Z|;Yx@YR@X@XWWJV=@V7@Ua@U>$T=@SRO@QQ'@QP`@POB5ONJ[MMc@MQ0@L@L@Ls@L/&@Kg@K@JJjI2IFFG~GGFtFvsDfD+@D@D@CtCqB,B@AAjuAR@4@?>C=t@=7@= <';[;;s;T(::f:W:K+@:K+@9D9@@8m8U8}@7g7=a6k@6<@6S@66P@6?55Ds@4L@4:@Fedora Release Engineering - 2.1.48-3Fedora Release Engineering - 2.1.48-2Ville Skyttä - 2.1.48-1Fedora Release Engineering - 2.1.47-2Ville Skyttä - 2.1.47-1Miroslav Lichvar - 2.1.46-2Ville Skyttä - 2.1.46-1Fedora Release Engineering - 2.1.45-2Ville Skyttä - 2.1.45-1Fedora Release Engineering - 2.1.44-2Ville Skyttä - 2.1.44-1Ville Skyttä - 2.1.43-1Fedora Release Engineering - 2.1.42-2Ville Skyttä - 2.1.42-1Fedora Release Engineering - 2.1.41-2Ville Skyttä - 2.1.41-1Fedora Release Engineering - 2.1.40-2Ville SkyttÈx82XLX HK $S F)D?$pd . q :G Ka|    @ T   (8 F98F:QFF -G @H PI `X dY p\ ] ^!b!c"d#(e#-f#0l#2t#Lu#\v#lz$$ $$$*$l$$& & (()0)4)8g)<h)@Cea-php74-php-calendar7.4.3318.24.7.cpanelEOL A module for PHP applications that need date/time calculationsphp 7.4 has reached End of Life. The php-calendar package delivers a module which will allow PHP scripts to do date and time conversions and calculations.jhou-1IEA4-production / CentOS_8cPanel, Inc.PHPDevelopment/Languageshttps://endoflife.date/phplinuxx86_649FAjmjjjb57099f2c20df193c2f7b4a1edbbe152ad4d927e3d2803e66fc455e37af2388688e305e1e712c94d26cfa4261b41d407f88ec6d6722b9d2c0e00ff7d6b780489../../../../opt/cpanel/ea-php74/root/usr/lib64/php/modules/calendar.sorootrootrootrootrootrootrootrootea-php74-php-7.4.33-18.24.7.cpanel.src.rpmconfig(ea-php74-php-calendar)ea-php74-php-calendarea-php74-php-calendar(x86-64)@@@@    @config(ea-php74-php-calendar)ea-php74-php-cli(x86-64)ea-php74-php-common(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel3.0.4-14.6.0-14.0-15.2-14.14.3iC@id@hgv@g@g~hg@fo@f@e4@ehy@eddu@dbd,@c@cs@cc@c5bbX b\@b@b[@ada@aa{a@@a@as@a]aV@aMa'@a@`ݮ@`ٹ``@`@`B@`@`__0@_Í@_@_F@__]@_"_u_R,@_P_+_@_^^n@^@^x^2^@^1^H^|@^f/^:@^Brian Mendoza - 7.4.33-18Gary Stanley - 7.4.33-17Chris Castillo - 7.4.33-16Cory McIntire - 7.4.33-15Dan Muey - 7.4.33-14Dan Muey - 7.4.33-13Julian Brown - 7.4.33-12Dan Muey - 7.4.33-11Julian Brown - 7.4.33-10Travis Holloway - 7.4.33-9Tim Mullin - 7.4.33-8Dan Muey - 7.4.33-7Travis Holloway - 7.4.33-6Julian Brown - 7.4.33-5Julian Brown - 7.4.33-4Tim Mullin - 7.4.33-3Travis Holloway - 7.4.33-2Cory McIntire - 7.4.33-1Cory McIntire - 7.4.32-1Cory McIntire - 7.4.30-1Cory McIntire - 7.4.29-1Travis Holloway - 7.4.28-2Cory McIntire - 7.4.28-1Tim Mullin - 7.4.27-5Julian Brown - 7.4.27-4Julian Brown - 7.4.27-3Julian Brown - 7.4.27-2Cory McIntire - 7.4.27-1Cory McIntire - x!XLH5$:ypes just like all of the other templates. - Change permissive domains creation to raise exception if sepolgen is not ins - get_te_results no longer needs or uses the opts parameter. - The compliler was complaining so I just removed the option. - Start returning analysis data for audit2allow- Update Translations - Fix handling of semanage generate --cgi -n MODULE PATHTO/CGI - This fixes the spec file and script file getting wrong names for modules and types.- Additional patch from Miroslav to handle role attributes- Update with Miroslav patch to handle role attributes - Update Translations - import sepolicy will only throw exception on missing policy iff selinux is enabled- Update to latest patches from eparis/Upstream - secon: add support for setrans color information in prompt output - Update translations- Update translations - Fix sepolicy booleans to handle autogenerated booleans descriptions - Cleanups of sepolicy manpage - Fix crash on git_shell man page generation- Update translations - update sepolicy manpage to generate fcontext equivalence data and to list default file context paths. - Add ability to generate policy for confined admins and domains like puppet.- Fix semanage permissive , this time with the patch. - Update translations- Fix semanage permissive - Change to use correct gtk forward button - Update po- Move audit2why to -devel package- sepolicy transition was blowing up. Also cleanup output when only source is specified. - sepolicy generate should allow policy modules names that include - or _- Apply patch from Miroslav to display proper range description in man pages g - Should print warning on missing default label when run in recusive mode iff - Remove extra -R description, and fix recursive description- Additional fixes for disabled SELinux Box - system-config-selinux no longer relies on lokkit for /etc/selinux/config- sepolicy should failover to installed policy file on a disabled SELinux box, if it exists.- Update Translations - sepolicy network -d needs to accept multiple domains- Add --path as a parameter to sepolicy generate - Print warning message if program does not exists when generating policy, and do not attempt to run nm command - Fix sepolicy generate -T to not take an argument, and supress the help message - Since this is really just a testing tool- Fix sepolicy communicate to handle invalid input- Fix sepolicy network -p to handle high ports- Fix handling of manpages without entrypoints, nsswitch domains - Update Translations- Move sepogen python bindings back into policycoreutils-python out of -devel, since sepolicy is using the- Fix sepolicy/__init__.py to handle _()- Add Miroslav Grepl patch to create etc_rw_t sock files policy- Fix semanage to work without policycoreutils-devel installed - Update translations- Fix semanage login -l to list contents of /etc/selinux/POLICY/logins directory- Fix booleansPage not showing booleans - Fix audit2allow -b- Fix sepolicy booleans again - Fix man page- Move policy generation tools into policycoreutils-devel- Document and fix sepolicy booleans - Update Translations - Fix several spelling mistakes- Only report restorecon warning for missing default label, if not running recusively - Update translations- Fix semanage booleans -l, move more boolean_dict handling into sepolicy - Update translations - Fixup sepolicy generate to discover /var/log, /var/run and /var/lib directories if they match the name - Fix kill function call should indicate signal_perms not kill capability - Error out cleanly in system-config-selinux, if it can not contact XServer- Remove run_init, no longer needed with systemd. - Fix sepolicy generate to not include subdirs in generated fcontext file. (mgrepl patch)- Fix manpage to generate proper man pages for alternate policy, basically allow me to build RHEL6 man pages on a Fedora 18 box, as long as I pull the policy, policy.xml and file_contexts and file_contexts.homedir- Fix some build problems in sepolicy manpage and sepolicy transition- Add alias man xXXL@ $ v7.4.24 to v7.4.25- ZC-9368: Correct build issues from changes to ea-tools- EA-10137: disable upstream regression tests in favor of our own- EA-10136: Update ea-php74 from v7.4.23 to v7.4.24- EA-10081: Update ea-php74 from v7.4.22 to v7.4.23- EA-10009: Update ea-php74 from v7.4.21 to v7.4.22- EA-9925: Update ea-php74 from v7.4.20 to v7.4.21- EA-9013: Optimize %check section- EA-9831: Update ea-php74 from v7.4.19 to v7.4.20- EA-9752: Update ea-php74 from v7.4.18 to v7.4.19- EA-9737: Update ea-php74 from v7.4.16 to v7.4.18- EA-9625: Update litespeed to 7.9- EA-9622: Update ea-php74 from v7.4.15 to v7.4.16- EA-9565: Update ea-php74 from v7.4.14 to v7.4.15- EA-9517: Update ea-php74 from v7.4.13 to v7.4.14- ZC-8005: Replace ea-openssl11 with system openssl on C8- EA-9448: Update ea-php74 from v7.4.12 to v7.4.13- EA-9424: Fix the build on CentOS 8- EA-9401: Update ea-php74 from v7.4.11 to v7.4.12- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- ZC-7497: Reinstate `runselftest`- EA-9339: Update ea-php74 from v7.4.10 to v7.4.11- EA-9281: Update litespeed from upstream to 7.8- EA-9282: Update ea-php74 from v7.4.9 to v7.4.10- EA-9224: Update ea-php74 from v7.4.8 to v7.4.9- EA-9189: Update litespeed from upstream to 7.7- EA-9150: Update ea-php74 from v7.4.7 to v7.4.8- ZC-6967: Build on C8- EA-9109: Update ea-php74 from v7.4.6 to v7.4.7- EA-9087: Fix PHP version in DSO description- EA-9072: Revert new .user.ini search behavior- EA-9070: Update ea-php74 from v7.4.5 to v7.4.6- ZC-6649: Re-enable multibyte regex for 7.4- EA-9014: Build ea-php74 with jpeg support- EA-9007: Update ea-php74 from v7.4.2 to v7.4.5- ZC-6287: Add php_intl with ea-libicu for C6- ZC-6287: Add libzip to zip Requires for C6- EA-8867: Update ea-php74 from v7.4.1 to v7.4.2- ZC-4640: Initial packaginghou-1 1788911297 7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel20-pgsql.ini30-pdo_pgsql.inipdo_pgsql.sopgsql.so.build-id3489874e35eda8e78d15e383fb14669ef20a36f537d7e6bf62021aaca435267c62b20f03b8849240/opt/cpanel/ea-php74/root/etc/php.d//opt/cpanel/ea-php74/root/usr/lib64/php/modules//usr/lib//usr/lib/.build-id//usr/lib/.build-id/34//usr/lib/.build-id/37/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectionobs://private/EA4-production/CentOS_8/466948582fa1dfb821c86fa7fa52fc38-ea-php74cpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=37d7e6bf62021aaca435267c62b20f03b8849240, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3489874e35eda8e78d15e383fb14669ef20a36f5, strippeddirectoryݏ=`Uutf-8bb95e75da269dd9484c1d9135d049a663c7542c7ff2a8c034627268e2580dd29?P"؉j#x~|:Xr"[{QXtO(D2|2q1T F^%@Nۚ C)S2pNm)wASK$SN|e5^LFh2\JdƂ;7ru]V5Dg:Y-N:TfƼ39NN{yx9ݘ>}QNԞ'Vҍ$4 +s.5xˋ~p_@jT^]vooS9|9ga2r{0ZQCUjHփ;*ж\8[L:I_MY/f1kd@;YsrXw%d~fd/ztq~_?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\1.5.0-1.cp130~el8Net_DNS2.xmlNetDNS2DNS2.phpBitMap.phpCacheCache.phpFile.phpShm.phpException.phpHeader.phpLookups.phpNotifier.phpPacketPacket.phpRequest.phpResponse.phpPrivateKey.phpQuestion.phpRRRR.phpA.phpAAAA.phpAFSDB.phpAMTRELAY.phpANY.phpAPL.phpATMA.phpAVC.phpCAA.phpCDNSKEY.phpCDS.phpCERT.phpCNAME.phpCSYNC.phpDHCID.phpDLV.phpDNAME.phpDNSKEY.phpDS.phpEID.phpEUI48.phpEUI64.phpHINFO.phpHIP.phpIPSECKEY.phpISDN.phpKEY.phpKX.phpL32.phpL64.phpLOC.phpLP.phpMX.phpNAPTR.phpNID.phpNIMLOC.phpNS.phpNSAP.phpNSEC.phpNSEC3.phpNSEC3PARAM.phpOPENPGPKEY.phpOPT.phpPTR.phpPX.phpRP.phpRRSIG.phpRT.phpSIG.phpSMIMEA.phpSOA.phpSPF.phpSRV.phpSSHFP.phpTA.phpTALINK.phpTKEY.phpTLSA.phpTSIG.phpTXT.phpTYPE65534.phpURI.phpWKS.phpX25.phpResolver.phpSocket.phpUpdater.phpdocscpanel-php84-net-dns2LICENSEREADME.md/usr/local/cpanel/3rdparty/php/84/lib/pear//usr/local/cpanel/3rdparty/php/84/lib/php//usr/local/cpanel/3rdparty/php/84/lib/php/Net//usr/local/cpanel/3rdparty/php/84/lib/php/Net/DNS2//usr/local/cpanel/3rdparty/php/84/lib/php/Net/DNS2/Cache//usr/local/cpanel/3rdparty/php/84/lib/php/Net/DNS2/Packet//usr/local/cpanel/3rdparty/php/84/lib/php/Net/DNS2/RR//usr/share/doc//usr/share/doc/cpanel-php84-net-dns2/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuXML 1.0 document, ASCII text, with very long linesdirectoryPHP script, ASCII textASCII textutf-8b8e0a2182a170adfc6e165f9d17d68d64fdee0a2d23e00f1cea4a97238ca55b3?0sF\04V_2`-C֐59fe6ac8e0ee0e7ccf4b790e4e738292d86409c848f45e40ffdff1320092f1d2f82b03e1125497a147922b4b15251331251b18a3j{xXL 7$'78H ?d$ ( OLPlpz  (  <  P  x     ( Z  $|S(89 :[cG HH Ip X|Y\ ] ^jbdnesfvlxt u vw x y<6 .  >6  t    g h Cperl-Time-Piece1.31423.el8_10Time objects from localtime and gmtimeThe Time::Piece module replaces the standard localtime and gmtime functions with implementations that return objects. It does so in a backwards compatible manner, so that using localtime or gmtime as documented in perlfunc still behave as expected.h02x64-builder03.almalinux.orgAlmaLinuxAlmaLinux(GPL+ or Artistic) and BSDAlmaLinux Packaging Team Unspecifiedhttp://www.perl.org/linuxx86_644]S^`d AA큤AA큤h0+h0+h/h/h/h/h/h/h/h/867b4b8f95dd3884258be8cb0496547860388136df4cbcda930d9f708f1c72255b10c0e7835a8012183598fdcd11271f29292a79531154dbc7c4b4200d4907c9571330cf2f677ee487e0245585c89e832c75ad5b8d23ea4c619798e4bfed780747759880f2581d52d251cca6f1839ddc8a7046bd57a36eba9e1ac647e615c07f44a1dcc2d476bdc62a4394672d275fc9cac33375cfb0d2bf6fbaae503f721d5c../../../../usr/lib64/perl5/auto/Time/Piece/Piece.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-5.26.3-423.el8_10.src.rpmperl(Time::Piece)perl(Time::Seconds)perl-Time-Pieceperl-Time-Piece(x86-64)@@@@@@@@@@ @@@@@@    @libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.4)(64bit)libperl.so.5.26()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)perl(:MODULE_COMPAT_5.26.3)perl(Carp)perl(DynaLoader)perl(Exporter)perl(Time::Local)perl(Time::Seconds)perl(constant)perl(integer)perl(overload)perl(strict)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)5.573.0.4-14.6.0-14.0-15.2-14.14.3he@cama`9@_@_ܙ_@\ @[<@[][CN@[Z@ZԐ@Z@Z}@ZyZs@Zo Zc/@Z\ZTYYYYY|xYyYS@YGY6@Y0XDX@XX@XXX|XwoXoXWX@X#X&WiW@WWPWWW~D@W~D@WzOWm Wj}WgWbW_W=WRR@Ra@R&R&R@Rv@RfhR-@R QQ@QQ@QکQcQQQbQ@QyQ?@QQQ@Qzl@QeT@QdQ^Q^QP<@QLGQJ@QHS@QC @QAQ5@Q"QQQ@QQ@Q@QQ @Q @QQsP@PP@PZPZP@PP~P`K@P\VP[@PXb@PS@PPy@PO'PG>P7lP(@P#@P#@P H@P O@OOROЗOF@OF@OȮOȮO]@Ot@OO~O@O@O OC@O/O (@O@O@NxNN@N1N@N=@NHN@N0NS@N @N$@N@N@NNN@NyNqNoEN\NGN;@N2N.@N)f@N%qN!}@NNpN*NM6@M6@M6@M@MMMxXL(4$44 29)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Perl 5.24 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 rebuild- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- 6.02 bump - Drop command macros - Modernize the spec - Correct the Lincense tag- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Perl mass rebuild- Use MIME type database from mailcap- Specfile autogenerated by cpanspec 1.78. - Remove BuildRoot stuff - Conflicts with perl-libwww-perl 5* and older6.026.02-15.module_el8.5.0+2812+ed912d05perl-LWP-MediaTypesChangesREADMELWP::MediaTypes.3pm.gzLWPMediaTypes.pmmedia.types/usr/share/doc//usr/share/doc/perl-LWP-MediaTypes//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/LWP/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mcpu=power8 -mtune=power8 -funwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnudirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Perl5 module source textPRRutf-8b37333a0e08c7d815766c3c1d15088f18d8d30af287e12fdd82334b829f0e606perl-libwww-perl:6.34:8060020220422081956:fbe42456?^!<ΰQd~bc Qd~ꈢ ?Y@ k-9DyB<cW\lu'E0N~RFl媱׏XVS0޴ڻ RanlzüQV9k rО1Aov[”w<$))3]2C6JF ;8芜5MV Ft::#@ U|T瀷y8JqkU_: zuz4+ -jH'YAۥCÅCα-Z > QLZ}ՉЛ[K3cA3f2}$y˃[(w ܽw4}31Wʤ.^Ʈ*̩t}ھRxT!<ΰQd~bc Qd~; uUƚNhf) 2>?yD&LJ)?ؼi*^ʎLnsEAZ>BDs  \bSL`ZK3KVjbS-pTthG?m_nlt û}A|.׆^t>3IֹͅԌe:%O >sq=苰m+UI!s囹vCJ$Gx sH\Gp"-JLy+W#bI&yO(g-~Xf?Zzzvf!hKg*z~@' g`؈yݶPzȔRq17?ie&0 { +au514e3196b5ed0f9a989812ea033a9eb785ee891c5c82020091de6a63a6f67b706d6579f874788a1ef524bcc2372c3fedff8de045j{xj{xgodaddy.cpython-39.pycpate gobstones.jsygoblet-line.svggoblet-fill.svgiagoaccesslQYego.pyA3 gnutls.pyB gnutls.mo0sgnutls.cpython-36.pyc/rgnutls.cpython-36.opt-1.pyce  /gnutlssh tgnus.pnghe gnupg2.mog gnupg2.7.gzKFignupg2y~g gnupg.info.gz}ygnupg.info-2.gz-cxXLo  $Q  rom v7.4.14 to v7.4.15- EA-9517: Update ea-php74 from v7.4.13 to v7.4.14- ZC-8005: Replace ea-openssl11 with system openssl on C8- EA-9448: Update ea-php74 from v7.4.12 to v7.4.13- EA-9424: Fix the build on CentOS 8- EA-9401: Update ea-php74 from v7.4.11 to v7.4.12- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- ZC-7497: Reinstate `runselftest`- EA-9339: Update ea-php74 from v7.4.10 to v7.4.11- EA-9281: Update litespeed from upstream to 7.8- EA-9282: Update ea-php74 from v7.4.9 to v7.4.10- EA-9224: Update ea-php74 from v7.4.8 to v7.4.9- EA-9189: Update litespeed from upstream to 7.7- EA-9150: Update ea-php74 from v7.4.7 to v7.4.8- ZC-6967: Build on C8- EA-9109: Update ea-php74 from v7.4.6 to v7.4.7- EA-9087: Fix PHP version in DSO description- EA-9072: Revert new .user.ini search behavior- EA-9070: Update ea-php74 from v7.4.5 to v7.4.6- ZC-6649: Re-enable multibyte regex for 7.4- EA-9014: Build ea-php74 with jpeg support- EA-9007: Update ea-php74 from v7.4.2 to v7.4.5- ZC-6287: Add php_intl with ea-libicu for C6- ZC-6287: Add libzip to zip Requires for C6- EA-8867: Update ea-php74 from v7.4.1 to v7.4.2- ZC-4640: Initial packaginghou-1 17889112977.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel20-calendar.inicalendar.so.build-id47dc0a648d68e355e93cf595bf63d3cfb7dc9b/opt/cpanel/ea-php74/root/etc/php.d//opt/cpanel/ea-php74/root/usr/lib64/php/modules//usr/lib//usr/lib/.build-id/94/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectionobs://private/EA4-production/CentOS_8/466948582fa1dfb821c86fa7fa52fc38-ea-php74cpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9447dc0a648d68e355e93cf595bf63d3cfb7dc9b, strippeddirectoryݏ=`Uutf-83ccfa88e548ef80fb63a05e9d6f28e07d497263357057209e5d541a90039774c?PXj#x~|% *ػV90ƴ[Ctu#߯@7̘Cy NI`>RJۖBq*p ͪQj3U R}bÖIy9s+7VeJƺ^'1!SH֯Jp8sFnu@bi3C V|I$_.'J Ymɉ wr$+ʩ3mSLܱ |;v%PꙋӄjG1?c%wVY֫8n0i +'2`VYӌV]9 1[7aSlĹ|E^H'j)>13_B;نUEA<ӕ:\3(ۙ܄}‚=Q,o( ܭ[;0Bsdz*qVj#x~|0v`2g6o zrwյ)Oƒi;h4.E .32vY+zGYCSn(N [k3J"$m$l@9' @zeEL&H4 ;eˑ'4B dCH-G=tYЁ<"&ڸ|Ayb4qow!bb5@"/6 %a&8zzb-9.=&B"I~]<3#U"QS틑UK=:%{ Qf$gJAoAr_XXul aF!zd:";uT}(<2)oHK+y<1wׄ__J2+z D•1,A]*хMm'+~8^p|lG-i S@Lj R.xG mw7<8lJ鲤 g k>(.W|BM)X6yNW%J66315b11b14d4d5bfc202f15a4167a4de9ec58bf071bd5ec84ceeaff611a48cb2dfd10a9f23fbc26226717cbfa39d7acaa768405j8j8n superfluous ioctl PCM ops (Jaroslav Kysela) [1797509] - [sound] ALSA: spi: Use managed buffer allocation (Jaroslav Kysela) [1797509] - [sound] ALSA: spi: More constification (Jaroslav Kysela) [1797509] - [sound] ALSA: sparc: Constify snd_device_ops definitions (Jaroslav Kysela) [1797509] - [sound] ALSA: sparc: More constifications (Jaroslav Kysela) [1797509] - [sound] ALSA: sparc: Constify snd_kcontrol_new items (Jaroslav Kysela) [1797509] - [sound] ALSA: sparc: Drop superfluous ioctl PCM ops (Jaroslav Kysela) [xXL% PH$hHHH12862dc7667b205eae0f1477cc17a580cb88e11a62107b1b6cde37a1c76fced6f91b390d98ed5aecff8c2d99d77a6473269367d5b085ad0db189d9699c2f47dcb97ae5ad348df688098756c307e421516ddf228af4ae9d777de0c8d11c989ae540ff22956a5a155bdeff392dffc381b1487b6e9493a7aadb52f851f78ec29316decf50d88df589faacdfcde3167ab426054625ccf0ca8255a24dc7752f58543edbc93216b53b17290952cba25a671e0434a01b5693855cb5d19ba777adb302779b050d8b0d3c7../../../../usr/lib64/lua/5.3/socket/unix.so../../../../usr/lib64/lua/5.3/socket/core.so../../../../usr/lib64/lua/5.3/socket/serial.so../../../../usr/lib64/lua/5.3/mime/core.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlua-socket-3.0-0.17.rc1.el8.src.rpmlua-socketlua-socket(x86-64)@@@@@     @libc.so.6()(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)luarpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)5.33.0.4-14.6.0-14.0-15.2-14.14.2ZԐ@Z|;Y@Yx@X@V=@Ua@UOH@UG_@U T@S@SS}R-@RNQQ@QPON@MQ0@JjI2GiG@Rafael dos Santos - 3.0-0.17.rc1Fedora Release Engineering - 3.0-0.16.rc1Fedora Release Engineering - 3.0-0.15.rc1Fedora Release Engineering - 3.0-0.14.rc1Fedora Release Engineering - 3.0-0.13.rc1Fedora Release Engineering - 3.0-0.12.rc1Fedora Release Engineering - 3.0-0.11.rc1Robert Scheck 3.0-0.10.rc1Robert Scheck 3.0-0.9.rc1Bastien Nocera 3.0-0.8rc1.1Tom Callaway - 3.0-0.8rc1Fedora Release Engineering - 3.0-0.7rc1Fedora Release Engineering - 3.0-0.6rc1Jan Kaluza - 3.0-0.5rc1Matěj Cepl - 3.0-0.4rc1Matěj Cepl - 3.0-0.3rc1Fedora Release Engineering - 2.1-0.2.rc1Tom Callaway - 2.1-0.1.rc1Fedora Release Engineering - 2.0.2-9Fedora Release Engineering - 2.0.2-8Fedora Release Engineering - 2.0.2-7Matthew Garrett - 2.0.2-6Fedora Release Engineering - 2.0.2-5Fedora Release Engineering - 2.0.2-4Fedora Release Engineering - 2.0.2-3Tim Niemueller - 2.0.2-2Tim Niemueller - 2.0.2-1- Use standard Fedora linker flags (bug #1548713)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/FexX LdD$tdDcDeDootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootxkeyboard-config-2.28-1.el8.src.rpmxkeyboard-config    rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.2])[?Y[@[{@Zz@ZqYp@YYyY0YXXXXEVW@WQq@VV@VvVy;@V@U@UeT Ta@THT+SP@SR>RR@QB@Q@Q@Q?@QxQm=@Q \P!@PPPd?P @O@O]@O@O*zOKOOn@NNFMM@M{@M3@MUMMMzMOMA^@Peter Hutterer 2.28-1Peter Hutterer 2.24-3Peter Hutterer 2.24-2Peter Hutterer 2.24-1Peter Hutterer 2.23.1-1Peter Hutterer 2.23-1Peter Hutterer 2.22-1Peter Hutterer 2.21-3Fedora Release Engineering - 2.21-2Peter Hutterer 2.21-1Hans de Goede - 2.20-4Fedora Release Engineering - 2.20-3Peter Hutterer 2.20-2Peter Hutterer 2.20-1Peter Hutterer 2.19-2Peter Hutterer 2.19-1Peter Hutterer 2.18-1Fedora Release Engineering - 2.17-2Peter Hutterer 2.17-1Peter Hutterer Peter Hutterer 2.16-2Peter Hutterer 2.16-1FxXLG$oGGF T? d&, 8 n ,0 <R    <   ,T| ,  (*849D:,>@BG H,ILXTYXZl[p\t]^ b Ed e f l t u v  \ ` f       < @ Hg Lh PCcpanel-php84-date-holidays-slovenia0.1.21.cp130~el8Driver based class to calculate holidays in Slovenia.Date_Holidays helps you calculate the dates and titles of holidays and other special celebrations. This is the driver for calculating holidays in Slovenia.hC|rbh-centos-8.dev.cpanel.net!/PHP LicenseDevelopment/Librarieshttp://pear.php.net/package/Date_Holidays_Slovenialinuxnoarchecho /usr/local/cpanel/3rdparty/php/84/lib/pear/Date_Holidays_Slovenia.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place. if [ x$1 = x0 ]; then echo pear.php.net/Date_Holidays_Slovenia >> /var/cpanel/.pending_pear_deregistrations ; fi AAA큤AA큤H6hC|rhC|rhC|rhC|rhC|rhC|rhC|r19108a7c4b80e35d93cd2b5e0178d017162f57a2e1606430c86f1676ebb5f8a5b725ce37fc19c205bc667aa90b1b5181dc61b099d13a1533b0f060e36dd9ba9de3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php84-date-holidays-slovenia-0.1.2-1.cp130~el8.src.rpmcpanel-php84-date-holidays-slovenia      /bin/sh/bin/shcpanel-php84cpanel-php84cpanel-php84cpanel-php84-date-holidaysrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)0.18.03.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3hAg$HH!Sloane Bernstein - 0.1.2-1.cp130~el8Andy Baugh - 0.1.2-2.cp118Todd Rinaldo - 0.1.2-1.cp118Todd Rinaldo - 0.1.0-1.cp118- Build for cPanel 130- Fix changelog generation- Slight changes to testsuite so it works when installed rather than in developers environment.- initial pear release/bin/sh/bin/shcpanel-php83-date-holidays-slovenia0.1.2-1.cp130~el8Date_Holidays_Slovenia.xmlDateHolidaysDriverSlovenia.phpdocscpanel-php84-date-holidays-slovenianodocs/usr/local/cpanel/3rdparty/php/84/lib/pear//usr/local/cpanel/3rdparty/php/84/lib/php//usr/local/cpanel/3rdparty/php/84/lib/php/Date//usr/local/cpanel/3rdparty/php/84/lib/php/Date/Holidays//usr/local/cpanel/3rdparty/php/84/lib/php/Date/Holidays/Driver//usr/share/doc//usr/share/doc/cpanel-php84-date-holidays-slovenia/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protx`|XLȗ9$!- Rebuilt for gcc bug 634757- Move restorecond into its own subpackage- Fix semanage man page- Add seremote, to allow the execution of command inside the sandbox from outside the sandbox.- Fix sandbox copyfile when copying a dir with a socket, print error- Stop polgengui from crashing if selinux policy is not installed- Fix bug preventing sandbox from using -l- Eliminate quotes fro desktop files- Add -w windowsize patch from Christoph A.- Update po- Update po- Tighten down seunshare to create /tmp dir with sticky bit and MS_NODEV | MS_NOSUID | MS_NOEXEC; - Remove setsid on seunshare so ^c on sandbox will cause apps to exit - Add dbus-launch --exit-with-session so all processes launched within the sandbox exit with the sandbox - Clean up error handling so error will get sent back to sandbox tool- Fix translation handling in file context page of system-config-selinux- Fix sandbox error handling- Apply patch to restorecond from Chris Adams, which will cause restorecond - to watch first user that logs in.- Add COPYING file to doc dir- Update po and translations Resolves: #610473- More fixes for polgen tools- Remove requirement to run selinux-polgen as root- Update po and translations - Fix gui policy generation tools- Update po and translations- rebuild against python 2.7- Update selinux-polgengui to sepolgen policy generation- Fix invalid free in seunshare and fix man page- Update translations- Fix sandbox man page- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- Add translations for menus - Fixup man page from Russell Coker- Change python scripts to use -s flag - Update po- Update to upstream * Add sandbox support from Dan Walsh with modifications from Steve Lawrence.- Fix sepolgen code generation Resolve: #603001- Add cgroup support for sandbox- Allow creation of /var/cache/DOMAIN from sepolgen- Fix sandbox init script - Add dbus-launch to sandbox -X Resolve: #599599- Move genhomedircon.8 to same package as genhomedircon - Fix sandbox to pass unit test Resolves: #595796- Fix listing of booleans from audit2allow- Fix audit2allow to output if the current policy has avc - Update translations - Fix icon- Man page fixes - sandbox fixes - Move seunshare to base package- Fix seunshare translations - Fix seunshare to work on all arches - Fix icon for system-config-selinux Resolves: #595276- Fix can_exec definition in sepolgen- Add man page for seunshare and genhomedircon Resolves: #594303 - Fix node management via semanage- Fixes from upstream for sandbox command Resolves: #580938- Fix sandbox error handling on copyfile - Fix desktop files- Fix policy tool to have correct name in menus - Fix seunshare to handle /tmp being in ~/home - Fix saving of altered files - Update translations- Allow audit2allow to specify alternative policy file for analysis- Update po - Fix sepolgen --no_attrs Resolves: #588280- Make semanage boolean work on disabled machines and during livecd xguest - Fix homedir and tmpdir handling in sandbox Resolves: #587263- Make semanage boolean work on disabled machines- Make sepolgen-ifgen be quiet- Make sepolgen report on more interfaces - Fix system-config-selinux display of modules- Fix crash when args are empty Resolves: #582542 - Fix semange to exit on bad options - Fix semanage dontaudit man page section Resolves: #582533- Remove debug line from semanage - Update po- Fix sandbox comment on HOMEDIRS - Fix sandbox to throw error on bad executable- Fix spacing in templates- Fix semanage return codes- Fix sepolgen to confirm to the "Reference Policy Style Guide"- Update to upstream * Add avc's since boot from Dan Walsh. * Fix unit tests from Dan Walsh.- Update to upstream - sepolgen * Add since-last-boot option to audit2allow from Dan Walsh. * Fix sepolgen output to match what Chris expects for upstream refpolicy from Dan Walsh.- Allow restorecon on > 2 Gig files- Fix semanage handling of boolean options - Update translations- Update to upstream x(lXtLG w$sion in VERSION.cmake (Michal Luscon) - initialize to use tito (Michal Luscon) - prepare repo for tito build system (Michal Luscon) - spec: recommends bash-completion (RhBug:1190671) (Jan Silhan) - completion: work with just python(3)-dnf (Jan Silhan) - spec: move necessary files inside python(3) subpackages (RhBug:1191579) (Jan Silhan) - bash-completion: use python method to get commands (RhBug:1187579) (Igor Gnatenko) - api: exposed pluginconfpath main config (RhBug:1195325) (Jan Silhan) - updated AUTHORS (Jan Silhan) - add reinstall to bash_completion (Alberto Ruiz) - added new packages to @System for duplicated query test (Michael Mraka) - test for duplicated, installonly and latest_limit pkgs (Michael Mraka) - tests for autoremove, extras and recent pkgs (Michael Mraka) - moved push_userinstalled from base to goal (Michael Mraka) - filter or skip 'n' latest packages (Michael Mraka) - moved recent to query (Michael Mraka) - moved autoremove to query (Michael Mraka) - moved extras list to query (Michael Mraka) - create query for installonly packages (Michael Mraka) - create query for duplicated packages (Michael Mraka) - cosmetic: base: fixed pylint warnings (Jan Silhan) - do transaction cleanup after plugin hook (RhBug:1185977) (Michal Luscon) - base: extend download lock (RhBug:1157233) (Michal Luscon) - lock: output meaningful error for malformed lock file (Michal Luscon) - util: fix race condition in ensure_dir() (Michal Luscon) - lock: switch metadata lock to blocking mode (Michal Luscon) - install nonmandatory group packages as optional (Related:RhBug:1167881) (Michal Luscon) - remove command deletes whole dependency tree (RhBug:1154202) (Jan Silhan) - cmd list takes as parameter, revert of 526e674 (Jan Silhan) - spec: own /var/lib/dnf directory (RhBug:1198999) (Jan Silhan) - transifex update (Jan Silhan) - doc: fixed systemd execution of dnf-automatic (Jan Silhan) - doc: how to run dnf-automatic (RhBug:1195240) (Jan Silhan) - cosmetic: added forgotten :api mark from 05b03fc (Jan Silhan) - api: exposed Repo.skip_if_unavailable config (RhBug:1189083) (Jan Silhan) - updated documentation for 'dnf list autoremove' (Michael Mraka) - reuse list_autoremove() in autoremove command (Michael Mraka) - function for autoremove package list (Michael Mraka) - implemented dnf list autoremove (Michael Mraka) - exclude not documented history subcommands (RhBug:1193914,1193915) (Jan Silhan) - better file pattern recognition (RhBug:1195385) (Jan Silhan) - spec: fix Obsoletes of the new DNF (Radek Holy) - remove boot only constraint and add missing download lock (Michal Luscon) - util: remove unused user_run_dir() function (Michal Luscon) - lock: change the destination folder of locks to allow suided programs work properly (RhBug:1195661) (Michal Luscon) - install dnf-3 only when python3 is enabled (thanks glensc) (Jan Silhan) - fixed unicode Download error (RhBug:1190458) (Jan Silhan) - log: print metadata age along with timestamp (Petr Spacek) - cli: fix double expansion of cachedir (RhBug:1194685) (Michal Luscon) - removed unused dnf-makecache.cron (Jan Silhan) - renamed erase command to remove (RhBug:1160806) (Jan Silhan) - spec: made python3-dnf package installed by default in f23 (Jan Silhan) - AUTHORS: changed email address (Jan Silhan) - doc: improve the documentation of the "install" command (Radek Holy) - "dnf install non-existent" should fail (Radek Holy) - tests: add some tests of Base.install (Radek Holy) - tests: add some tests of Base.package_install (Radek Holy) - Revert "doesn't upgrade packages by installing local packages" (RhBug:1160950) (Radek Holy) - lint: fix all Pylint errors in test_install (Radek Holy) - tests: add some tests to test_install (Radek Holy) - tests: improve some tests in test_install (Radek Holy) - cosmetic: reorder tests in test_install (Radek Holy) - cosmetic: rename some tests in test_install and add some docstrings (Radek Holy) - AUTHORS: updated (Jan Silhan) - Add support for armv6hl (Peter Hjalmarsson) - doc: subject.__init__(): what is pkgx[XL 0$S000so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libnsl.so.2()(64bit)libnsl.so.2(LIBNSL_1.0)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)tcp_wrappers-libs(x86-64)3.0.4-14.6.0-14.0-15.2-17.6-96.el84.14.2_!d^4]<<\V[IZ2@Z%Z}@ZqY@YyXX<@VՄ@VU@T@SSSP@R QB@Q@QQQh@P On@NJ[NI @NI @NBrM۝M?MRLKl@KD{@JlE@IzI2HG@GF@F;@FFfFZ@FVF#e@EL@EE@Et D@C@CCCqB{\@B @Ae/Aa;@@@Hk@Dw@@,@>@>O}@>H>G@>G@>.>@='=@=@<<<0:h:~:M@:9@9$@9l]9<9!8@8777K@6@65޲5;5Q@44W%@3 @3@Fedora Release Engineering - 7.6-96Fedora Release Engineering - 7.6-95Fedora Release Engineering - 7.6-94Fedora Release Engineering - 7.6-93Fedora Release Engineering - 7.6-92Jakub Jelen - 7.6-91Jakub Jelen - 7.6-90Fedora Release Engineering - 7.6-89Jakub Jelen - 7.6-88Fedora Release Engineering - 7.6-87Fedora Release Engineering - 7.6-86Fedora Release Engineering - 7.6-85Jakub Jelen - 7.6-84Jakub Jelen 7.6-83Fedora Release Engineering - 7.6-82Fedora Release Engineering - 7.6-81Jakub Jelen 7.6-80Fedora Release Engineering - 7.6-79Tom Callaway - 7.6-78Fedora Release Engineering - 7.6-77Petr Lautrbach 7.6-76Fedora Release Engineering - 7.6-75Petr Lautrbach 7.6-74Viktor Hercinger - 7.6-73Viktor Hercinger - 7.6-72Viktor Hercinger - 7.6-71Fedora Release Engineering - 7.6-70Fedora Release Engineering - 7.6-69Jan F. Chadima - 7.6-68Jan F. Chadima - 7.6-67Jan F. Chadima - 7.6-66Jan F. Chadima - 7.6-65Jan F. Chadima - 7.6-64Jan F. Chadima - 7.6-61Fedora Release Engineering - 7.6-60Jan F. Chadima - 7.6-59Jan F. Chadima - 7.6-58Jan F. Chadima - 7.6-57Fedora Release Engineering - 7.6-56Jan F. Chadima - 7.6-55Fedora Release Engineering - 7.6-54Jan Safranek - 7.6-53Fedora Release Engineering - 7.6-52Tomas Janousek - 7.6-51Tomas Janousek - 7.6-50Tomas Janousek - 7.6-49Tomas Janousek - 7.6-48Tomas Janousek - 7.6-47Tomas Janousek - 7.6-46Tomas Janousek - 7.6-45Tomas Janousek - 7.6-44Tomas Janousek - 7.6-43Tomas Janousek - 7.6-42.1Tomas Janousek - 7.6-42Thomas Woerner 7.6-41Jesse Keating - 7.6-40.2.1Jesse Keating - 7.6-40.2Jesse Keating - 7.6-40.1Thomas Woerner 7.6-40Jesse Keating Thomas Woerner 7.6-39Thomas Woerner 7.6-38Thomas Woerner 7.6-37.2Thomas Woerner JXLO$fOO Nenko - 1.6.8-2Paul Wouters - 1.6.8-1Zbigniew Jędrzejewski-Szmek - 1.6.7-2Paul Wouters - 1.6.7-1Petr Menšík - 1.6.6-3Paul Wouters - 1.6.6-2Paul Wouters - 1.6.6-1Paul Wouters - 1.6.4-4Fedora Release Engineering - 1.6.4-3Fedora Release Engineering - 1.6.4-2Paul Wouters - 1.6.4-1Paul Wouters - 1.6.4-0.rc2Paul Wouters - 1.6.3-1Paul Wouters - 1.6.2-2Paul Wouters - 1.6.2-1Paul Wouters - 1.6.0-6Fedora Release Engineering - 1.6.0-5Paul Wouters - 1.6.0-4Paul Wouters - 1.6.0-3Paul Wouters - 1.6.0-2Kevin Fenzi - 1.6.0-1Miro Hrončok - 1.5.10-3Ilya Evseev - 1.5.10-2Paul Wouters - 1.5.10-1Fedora Release Engineering - 1.5.9-4Paul Wouters - 1.5.9-3Paul Wouters - 1.5.9-2Paul Wouters - 1.5.9-1Toshio Kuratomi - 1.5.8-2Paul Wouters - 1.5.8-1Fedora Release Engineering - 1.5.7-3Tomas Hozza - 1.5.7-2Paul Wouters - 1.5.7-1Tomas Hozza - 1.5.6-1Robert Kuska - 1.5.5-2Tomas Hozza - 1.5.5-1Tomas Hozza - 1.5.4-5Tomas Hozza - 1.5.4-4Tomas Hozza - 1.5.4-3Tomas Hozza - 1.5.4-2Paul Wouters - 1.5.4-1Tomas Hozza - 1.5.3-8Tomas Hozza - 1.5.3-7Tomas Hozza - 1.5.3-6Tomas Hozza - 1.5.3-5Paul Wouters - 1.5.3-4Tomas Hozza - 1.5.3-3Tomas Hozza - 1.5.3-2Paul Wouters - 1.5.3-1Paul Wouters - 1.5.1-4Paul Wouters - 1.5.1-3Paul Wouters - 1.5.1-2Paul Wouters - 1.5.1-1Tomas Hozza - 1.5.1-0.1.rc1Marcin Juszkiewicz - 1.5.0-3Tomas Hozza - 1.5.0-2Tomas Hozza - 1.5.0-1Pavel Šimerda - 1.4.22-6Kevin Fenzi - 1.4.22-5Fedora Release Engineering - 1.4.22-4Fedora Release Engineering - 1.4.22-3Paul Wouters - 1.4.22-2Paul Wouters - 1.4.22-1Tomas Hozza - 1.4.21-3Tomas Hozza - 1.4.21-2Paul Wouters - 1.4.21-1Tomas Hozza - 1.4.20-19Paul Wouters - 1.4.20-18Fedora Release Engineering - 1.4.20-17Tomas Hozza - 1.4.20-16Paul Wouters - 1.4.20-15Tomas Hozza - 1.4.20-14Paul Wouters - 1.4.20-13Paul Wouters - 1.4.20-12Paul Wouters - 1.4.20-10Paul Wouters - 1.4.20-8Paul Wouters - 1.4.20-7Paul Wouters - 1.4.20-6Paul Wouters - 1.4.20-5Paul Wouters - 1.4.20-4Adam Tkac - 1.4.19-5Fedora Release Engineering - 1.4.19-4Paul Wouters - 1.4.19-3Paul Wouters - 1.4.18-6Paul Wouters - 1.4.18-5Paul Wouters 1.29.26-6Dan Walsh 1.29.26-5Dan Walsh 1.29.26-4Dan Walsh 1.29.26-3Dan Walsh 1.29.26-2Dan Walsh 1.29.26-1Dan Walsh 1.29.23-1Jesse Keating - 1.29.20-2.1Dan Walsh 1.29.20-2Dan Walsh 1.29.20-1Jesse Keating - 1.29.18-2.1Dan Walsh 1.29.18-2Dan Walsh 1.29.18-1Dan Walsh 1.29.17-1Dan Walsh 1.29.15-1Dan Walsh 1.29.12-1Dan Walsh 1.29.11-3Dan Walsh 1.29.11-2Dan Walsh 1.29.11-1Dan Walsh 1.29.9-2Dan Walsh 1.29.9-1Dan Walsh 1.29.8-4Dan Walsh 1.29.8-3Dan Walsh 1.29.8-2Dan Walsh 1.29.8-1Dan Walsh 1.29.7-4Dan Walsh 1.29.7-3Dan Walsh 1.29.7-2Dan Walsh 1.29.7-1Dan Walsh 1.29.5-3Dan Walsh 1.29.5-2Dan Walsh 1.29.5-1Dan Walsh 1.29.4-1Dan Walsh 1.29.3-1Dan Walsh 1.29.2-10Dan Walsh 1.29.2-9Dan Walsh 1.29.2-8Dan Walsh 1.29.2-7Dan Walsh 1.29.2-6Dan Walsh 1.29.2-5Dan Walsh 1.29.2-4Dan Walsh 1.29.2-3Dan Walsh 1.29.2-1Dan Walsh 1.29.1-2Jesse Keating Dan Walsh 1.29.1-1Dan Walsh 1.28-1Dan Walsh 1.27.37-1Dan Walsh 1.27.36-2Dan Walsh 1.27.36-1Dan Walsh 1.27.35-1Dan Walsh 1.27.33-1Dan Walsh 1.27.31-1Dan Walsh 1.27.30-1Dan Walsh 1.27.29-1Dan Walsh 1.27.28-3Dan Walsh 1.27.28-2Dan Walsh 1.27.27-5Dan Walsh 1.27.27-3Dan Walsh 1.27.27-1Dan Walsh 1.27.26-4Dan Walsh 1.27.26-1Dan Walsh 1.27.23-1Dan Walsh 1.27.20-1Dan Walsh 1.27.19-2Dan Walsh 1.27.19-1Dan Walsh 1.27.18-1Dan Walsh 1.27.14-1Dan Walsh 1.27.13-1Dan Walsh 1.27.12-1Dan Walsh 1.27.11-1Dan Walsh 1.27.7-2Dan Walsh 1.27.7-1Dan Walsh 1.27.6-1Dan Walsh 1.27.5-3Dan Walsh 1.27.5-1Dan Walsh 1.27.3-2Dan Walsh 1.27.3-1Dan Walsh 1.27.2-2Dan Walsh 1.27.2-1Dan Walsh 1.27.1-1Dan Walsh 1.26-3Dan Walsh 1.26-2Dan Walsh 1.26-1Dan Walsh 1.25.9-2Dan Walsh 1.25.9-1Dan Walsh 1.25.7-3Dan Walsh 1.25.7-2Dan Walsh 1.25.7-1Dan Walsh 1.25.6-1Dan Walsh 1.25.5-3Dan Walsh 1.25.5-2Dan Walsh 1.25.5-1Dan Walsh 1.25.4-1Dan Walsh 1.25.3-1Dan Walsh 1.25.2-1Dan Walsh 1.25.1-1Dan Walsh 1.24-1Dan Walsh 1.23.11-4Dan Walsh 1.23.11-3Dan Walsh 1.23.11-2Dan Walsh 1.23.11-1Dan Walsh 1.23.10-2Dan Walsh - 6.3-1.cp130Busy Camels - 5.2-1.cp108Busy Camels - 5.2-1.cp1198Todd Rinaldo - 5.2-1.cp1156Todd Rinaldo - 5.1-1.cp1144Todd Rinaldo - 4.0-1.cp1136- Update from upstream: Module-Pluggable 6.3- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Module-Pluggable 5.2 - Don't warn about deprecation on CPAN module- Update from upstream: Module-Pluggable 5.1- Update from upstream: Module-Pluggable 4.00.46.35.20.46.3-1.cp130~el85.20.46.35.2InnerPackage.pmPluggable.pmObject.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Devel//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Module//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Module/Pluggable/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8aad4a306cdd2879310e4f2cda457becbc27fddd6b8e636446f2b735ffe7f1dd6?3xwЌD̥bBp 6814e6731430d866fda8bd146342ea4a2f9ef7ba0bb6d5f33924a7a3362051ca5fcf05c001126c22e585faa0e3c0bf8dfede04aaj{Xvj{U~ labels.pyxXLF 0H$RH;K?<?|d + J h   P     @  b    4 ( 8 9 :5G HIX(Y,\@]^rbdefltuv,06x  0g4h8Ccpanel-common-licenses1.0.01.cp130~el8Common licenses used by cPanelProvide common public licenses: GPL, LGPL, GFDL, BSD, Artistic...h7|bh-centos-8.dev.cpanel.netGNU General Public LicensecPanelhttps://cpanel.netlinuxnoarch,^GGZYOYK1XFK^c%g4AUM+dAU &h7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zh7zcfc7749b96f63bd31c3c42b5c471bf756814053e847c10f3eb003417bc523d30b7fd9b73ea99602016a326e0b62e6646060d18febdd065ceca8bb482208c3d885d588eb3b157d52112afea935c88a7ff9efddc1e2d95a42c25d3b96ad90550081cdce7a9807765e67012714b304d324aace712838655cccbac32b524e5f3f63c905d05f127186edb9c2d487002615a4c79e9b24e80839797ab067081c812da03a9cc56c6f6de291817c5c9d8479df325e3387d42ce3cb7d7d8285cbf84f00cd3a9cc56c6f6de291817c5c9d8479df325e3387d42ce3cb7d7d8285cbf84f00cd39879ad355db0cd1c5bd0938b0f48feeaf51cf069972ba7ebce94d13a2b33e39c45eed0cc6911d05c17fcddda7aa2ad17e244a0be495c9ec3a6523d0befe46b59165704219ce3d94789c8498cf4a1130e01e0bd4532a744164562f9d7f4e4495a0eab5316383faa2492b3f1a9c543c836a4b68c070b8f62ca51dbf1f54376a46c165704219ce3d94789c8498cf4a1130e01e0bd4532a744164562f9d7f4e4495a8ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b903d77d235e41d54594865151f4751e835c5a82322b0e87ace266567c3391a4b9128177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b8806438ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b9036e78f553942bd83fba06f3eb3e6097d6cfbfd9f92d2b61bf9e528d0651d751f6da7eabb7bafdf7d3ae5e9f223aa5bdc1eece45ac569dc21b3b037520b4464768681e386e44a19d7d0674b4320272c90e66b6610b741e7e6305f8219c42e85366dc626520dcd53a22f727af3ee42c770e56c97a64fe3adb063799d8ab032fe551da7eabb7bafdf7d3ae5e9f223aa5bdc1eece45ac569dc21b3b037520b4464768e385029ee9b9db3e57185b4d5285e0255e2bd31b1ed1ffc2d2244ff7dfa864a01f256ecad192880510e84ad60474eab7589218784b9a50bc7ceee34c2b91f1d585f34250a23e673dda37fc2cbfe32692b109471ae985c194301d48af5b16fe0abb4680b13c3190429464a8308a07d7d891e6454349fb7be856e02405b25b11951f256ecad192880510e84ad60474eab7589218784b9a50bc7ceee34c2b91f1d5ecd004e9ae3fcf54896b562d5e8008e36041f2620076effd58e5f4187299cee8ecd004e9ae3fcf54896b562d5e8008e36041f2620076effd58e5f4187299cee8f95930fbf8b11e793882574b1c31ceb843b01f84e6bfdaa134fb048a73905d92rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-common-licenses-1.0.0-1.cp130~el8.src.rpmx`X L bD$rbDaDcDc3ed601cb7b73d6f938967d2a672eec8ebe5736f6f1b30491536ee5af1ef6f27e397742a900fe9ce3f58ed9c581a4dc13576326590dfad73e866c73ce566e704c2b28f40f6daeba60f841ea19f8ec94ee699243b5c5aecf22f6ca90f4b67dced4062894d6d77f4cc39343df9e359fc12f5e5d3c89ef2a3ef6d3897a70186138747dc00a471b3f6c5da7aa5408062c3d77e7f9d31ba5c6852826f071a9921beec2f02828691ead57ca487920d4e787409dc81d9a80d9b4e6abf4b00322cb6f2b24d29fe2d3f3b26a0bf1963436e82c81f32230631ff44626946da608dd77057164576486991a414cb496840cb0a7449a2098681e00c4472c24a66a1718e036fb2bce380abdb957fe70fc8ee3cce0e67cfbc257c5809d88c618a7bbcab8f09bec54b8e974b9c3ad44973bd21ec815c3be22d0e21f8638c2289cde3ea024ea2e6b1805f4506d6c5ee504323161f26b01801bceca48581af5a565d618e1af0ae3294cd85a77e5fd6b206f0798eee2d1f32b4dc5a7c1daa0cd87cee9c480ca7226583695215dc8cdc238be262d426fd58382a4918c5c3ce6cff8b37fa3281c235638b564c33984f1380c1dfad67f739101d8a3aad82b074e8dd11f637141654c2218d7fddb5662df09fa127b654645da8b2ee0f386d618c868159be0393328f94ea28d570284ab141aad79ea88d877e936a9fbf33f7cc24f1f8c72913ca4d89cd59482a27743c793c4db195170f1cd27b31fcaf4506d14ad691a67a1d2f6f17fcb1a70157b93aa6e6926d31207e68d1c9ea1aff45f9a2ff833b5879f273624c9df59fd9c1cc254ced893e9583c0aa18843fab428f2467f876d6611415c8b4bda34390135149a71b7e43d729581ef69cbfd6e2d46c7498b8e9f9640724fd6547942731610e770b7ffb2bff11fb1bb5ec58cc29b160fe3c0170222c198d2baf1849f529974f27a0de72ef69e1af44f0d8c7bb4eed4eaccd567d813b1eb4ac947b913ddd47010211e7d567bc4aea453d0188e74e49c8972d18431983b948c5682deedc42bc2681981100600ac5bb9d6f42c361572d89f300a3cb4d1a529127af558f91be4074decdff4ed753c9327fb3e43d7e5484b200df2d00a23a5c31ef28aea2b56208a3d42a259036992b601de19067ac44d0745b6e2f7df187b3c82420b2893af4d24a5f34bea975437ed38291b03a347d09adf6e6e110d145c76ccaa661aabe4f25c6273075ce7feb63f6dc727efed45f4495ee2bc9bd121b47959ee2509e0935b74c7041b73a8ddb06af5a26bc60cab4d1892dad34615c3098e591c531f7fdb273fcb4767e485f657365ac4b86e168786c0444b34df4ddc8e6d59353c923079d417ec726fb8cfd727b291ff07920ccfc8f863505690b82b53ff060cb55c07dc813f7f2fc3a9f709e5bb81b2f65cce3af05511c29dce97704980fbd95219404f464100025f855cebec85f51e9418948d542abbf56ff7821a5b47ccda144ca5a7295768dde1e7e463be14d5a6b19023ea7f96aef89b02df97225f30129a8e9b822ea76579f8d5c105604160526266b49ba62765ad3ad99febe77d8fdab31659c4be4d2839695b78b14f950143b11c4a93b2416e5299030edaf801f3a6d2a87029e048e157600ae881cccc0cfc11c1c24165f24d46e775ee73dd529632dcce7d0aa0c38482651084b4e1fcfb0cbdef2497d928c48f334cb18875c218dd67d64afa3a1d3ba18a84eb8f1cf8e978cc805781663095126e96f00384e5b3588a526442bbd238da773ff73653ea27cb3d8fcb60ea8ef1566e41cde82965f2cb5adac5ba96603026bec62d037fea744e48a624134fd2621db79dc80f392610a4c88e5d0e1d32499943bbafa3e23b0d82bd9ee23a46c5189c3536f89eb72a4775e1178284d6b4746eede409cc3ada0b9c1e6b0c33fd552acf6c00793b6cc34cdba8eb2c2d46dba1cc0f19a98264fae4a70079929fe3a5a8dab7e453f002dada1922e10edf3e67de93f5759dca9ba1bfc381afa7c5763b947a26a0911eca4ae0db4fe4d3415d285e2871b0671b3afbd6f66b62ac871a425b04e0139f337e13b3ae6f08fa0cbde02c735f6aa214e020194e6742db1a752b58c440db56f515d1617f2e76cb632374987f6745b13657271f6ca7fdfdd7d27863e13f196b766f237dfaff056b7d6412a37e28f52f5b4d24b46f3f76f44c96fefde30527e5a035264488d5a570a44ab75df101a2fc5fcda5e8185f54f14b6db766872648362e2e76fec03812dd36265661e1ef11df883ffe230a8fff779389d31501e5b6ddd9cc4e04cdab28f19f88adc228927323567e15164b88443e2dc985ca1f3344be45d1d73d2dea510a67c3c377a9e437b879933ca442b4cce42a1be9131d482237c7ae1ac098c54c1e79fad236c49fcf8273fda3d0f7e76a209ed43129b6e67d344cf19034e45a7eb3b7b5349845d74027e8db69b6034c6a4cfeba52af1cdc82c7d9a3c1eb857b53aeb7918a1172748265c8a46334c0443b61f1b115971cff1bed8dca9basebase.lstbase.xmlx0XaLq$aqprm> - 4.0.4-1Jaroslav Mracek - 3.6.1-1Jaroslav Mracek - 3.5.1-1Jaroslav Mracek - 3.5.0-1Daniel Mach - 3.4.0-1Daniel Mach - 3.3.0-1Daniel Mach - 3.2.0-1Daniel Mach - 3.1.0-1Daniel Mach - 3.0.4-1Martin Hatina - 3.0.3-1Jaroslav Mracek - 3.0.2-1Jaroslav Mracek - 3.0.1-1Igor Gnatenko - 2.7.5-1Jaroslav Mracek - 2.7.4-1Igor Gnatenko - 2.7.3-1Jaroslav Mracek - 2.7.2-1Jaroslav Mracek 2.6.3-1Jaroslav Mracek 2.6.2-1Jaroslav Mracek 2.5.1-1Jaroslav Mracek 2.5.0-1Jaroslav Mracek 2.4.1-1Jaroslav Mracek 2.4.0-1Jaroslav Mracek 2.3.0-1Jaroslav Mracek 2.2.0-1Jaroslav Mracek 2.1.1-1Jaroslav Mracek 2.1.0-1Jaroslav Mracek 2.0.1-1Michal Luscon 2.0.0-1Martin Hatina 2.0.0-0.rc2.1Michal Luscon 2.0.0-0.rc1.1Igor Gnatenko - 1.1.10-2Igor Gnatenko - 1.1.10-1Igor Gnatenko - 1.1.9-6Igor Gnatenko - 1.1.9-5Igor Gnatenko - 1.1.9-4Fedora Release Engineering - 1.1.9-3Michal Luscon 1.1.9-2Igor Gnatenko 1.1.9-1Michal Luscon 1.1.8-1Michal Luscon 1.1.7-1Michal Luscon 1.1.6-1Michal Luscon 1.1.5-1Michal Luscon 1.1.4-1Michal Luscon 1.1.3-1Michal Luscon 1.1.2-4Michal Luscon 1.1.2-3Michal Luscon 1.1.2-2Michal Luscon 1.1.2-1Michal Luscon 1.1.1-2Michal Luscon 1.1.1-1Michal Luscon 1.1.0-2Michal Luscon 1.1.0-1Michal Luscon 1.0.2-3Jan Silhan 1.0.2-2Michal Luscon 1.0.2-1Michal Luscon 1.0.1-2Michal Luscon 1.0.1-1Michal Luscon 1.0.0-1Michal Luscon 0.6.5-1Jan Silhan - 0.6.4-1Jan Silhan - 0.6.3-2Jan Silhan - 0.6.3-1Jan Silhan - 0.6.2-1Jan Silhan - 0.6.1-1Aleš Kozumplík - 0.6.0-1Aleš Kozumplík - 0.5.5-1Aleš Kozumplík - 0.5.4-1Aleš Kozumplík - 0.5.3-1Aleš Kozumplík - 0.5.2-1Aleš Kozumplík - 0.5.1-1Aleš Kozumplík - 0.5.0-1Aleš Kozumplík - 0.4.19-1Aleš Kozumplík - 0.4.18-1Aleš Kozumplík - 0.4.17-1Aleš Kozumplík - 0.4.16-1- Added patch for almalinux bugtracker- automatic: catch OSError, not SMTPException on smtp errors (RHEL-71545) - automatic: Check availability of config file (RHEL-71545)- Remove /usr/bin from sys.path to avoid accidentally importing garbage (RHEL-1245) - Fix japanese translations (RHEL-6393) - Fix substitution in kay-value-pair list in add_new_repo (RHEL-11786)- Document symbols in `dnf history list` output (RhBug:2172067)- Return an error when transaction fails (RhBug:2170093)- Omit src RPMs from check-update (RhBug:2151910,2203069) - automatic: Fix online detection with proxy (RhBug:2022440,2189851)- Update translations- Ignore processing variable files with unsupported encoding (RhBug:2141215) - Better explain traceback oxqXfL> lI$|lImIvurity -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-86d63db74cbb61eb5eb7364dbfdc002d81a1791dee1fd4be516baeb956d33ed46?pϢ $ Macd9eb55aee2eed7a00107c8e075c60867d0f6d25bfc8777b0a3a57524ce69bbac6ab59c8ec4a3fb95537e10a41570308a74d85dj{r,j{UxX)L].$>.- gration - Close: rhbz#2071940- Rebuild for libdav1d soname bump in ELN- Update to 0.10.1 Close: rhbz#2073138- Rebuilt for https://fedoraproject.org/wiki/Fedora_36_Mass_Rebuild- Rebuild- Update to 0.9.3 Close: rhbz#2016224- Rebuilt for https://fedoraproject.org/wiki/Fedora_35_Mass_Rebuild- Rebuilt for aom v3.1.1- Update to 0.9.1 - Close: rhbz#1937556- Update to version 0.9.0- Build with aom- Build without aom for new vmaf version- Build release with debug info- Rebuilt for https://fedoraproject.org/wiki/Fedora_34_Mass_Rebuild- Rebuild for dav1d SONAME bump- Update to version 0.8.4- Update to version 0.8.2 https://github.com/AOMediaCodec/libavif/blob/master/CHANGELOG.md- Update to 0.8.1- Update to 0.8.0- Second attempt - Rebuilt for https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Update to 0.7.3- Update to version 0.7.2 * https://github.com/AOMediaCodec/libavif/blob/master/CHANGELOG.md- Update to version 0.7.1- Update to version 0.5.7- Fix License- Initial version0.10.1-3.el80.10.1-3.el8.build-id5190f2add8ec89b780dcc38a19836a7b548e5fdclibavif.so.14libavif.so.14.0.1libavifLICENSE/usr/lib//usr/lib/.build-id//usr/lib/.build-id/51//usr/lib64//usr/share/licenses//usr/share/licenses/libavif/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5190f2add8ec89b780dcc38a19836a7b548e5fdc, strippedUTF-8 Unicode text PRRRRRRRR RR RRhttps://bugz.fedoraproject.org/libavifutf-896377b207575caf6fc454af19cfc69698dfe2ed44df2288a128103684a07b72f?0P3!y덏%!E/֡b !E/֡RƊjYD]MnP߮f]}P4 dh񀝅G<,̑ImΦnN^>06F~;F֢upUPrAdee6hExePFD#Qh;,LQh d_}/U^~ ֶZ&Y]@ V]_=ouV튌gǍ卲z*XSxCPv $֊yT]!&h&t#; $xZJrq h  sB}NJ4\>nuI'yEEm͊Dĭ 3<ڠT8%2*N5ޗ3栩m{9R\nKH-O\S0S3QfYd7zГwTEjގJ1}2C!-^9)-y[ fе.G,ElCƠs%IMHV/*S4UI2Y9bv23!y덏%!E/֡b !E/֡  }~jPI.ҕ|Fy!T8$GfR,}? jQ8E 4tY1q0|-e+E5`mƞĖ'W2 v e?ulI5샾! ]K<+> nTp/%ţkWy5tjf 0DV Pt!&Y=Л}\_Z[ H׷̯-z{J#lLlQAzj6FH9-4a_r^VU|PG!kgfHk2}1 bop Q/СG߂6>H4.,2/ɣNo8`uH>լ[ |J)[5Hgȥ*6URy3ꖴ93rnNe{E>|ÅŃ)ӌ 6@+tlz1N&T [gnYTu"7m͓ALC`52ba8d8d03887689c6d245914537466aee07ce6ebfbf20fa68fd4d0c9c300022f004e278becf5e2e4b30d92731a6cb0c63316787j{xmgj{xl-perl-536-datetime-timezone-pacific-honolulucov.cpanel-perl-536-datetime-timezone-pacific-guamP5cpanel-perl-536-datetime-timezone-pacific-guadalcanal1cpanel-perl-536-datetime-timezone-pacific-gambierz3cpanel-perl-536-datetime-timezone-pacific-galapagoso_2cpanel-perl-536-datetime-timezone-pacific-funafutisl..cpanel-perl-536-datetime-timezone-pacific-fijiE11cpanel-perl-536-datetime-timezone-pacific-fakaofox@X! L&eD$ueDdDfDedora Release Engineering - 2.15-2Peter Hutterer 2.15-1Peter Hutterer 2.14-1Peter Hutterer 2.13-3Simone Caronni - 2.13-2Adam Jackson 2.13-1Fedora Release Engineering - 2.12-2Peter Hutterer 2.12-1Peter Hutterer 2.11-1Peter Hutterer 2.10.1-1Fedora Release Engineering - 2.9-4Peter Hutterer 2.9-3Peter Hutterer 2.9-2Peter Hutterer 2.9-1Daniel Drake 2.8-3Peter Hutterer 2.8-2Peter Hutterer 2.8-1Peter Hutterer 2.7-4Peter Hutterer - 2.7-3Peter Hutterer - 2.7-2Peter Hutterer 2.7-1Fedora Release Engineering - 2.6-3Peter Hutterer 2.6-2Peter Hutterer 2.6-1Peter Robinson - 2.5.1-2Peter Hutterer 2.5.1-1Peter Hutterer 2.5-1Peter Hutterer 2.4.1-4Fedora Release Engineering - 2.4.1-3Peter Hutterer 2.4.1-2Peter Hutterer 2.4.1-1Peter Hutterer 2.3-2Peter Hutterer 2.3-1Peter Hutterer 2.2.1-2.20110415git19a0026b5Peter Hutterer 2.2.1-1Peter Hutterer 2.2-1Matthias Clasen - 2.1.99-2Peter Hutterer 2.1.99-1.20110311-git9333b2f3Fedora Release Engineering - 2.1-2Peter Hutterer 2.1-1- xkeyboard-config 2.28 (#1728817)- Remove high-keycode removal patches, xkbcomp 1.4.2 has been in stable for long enough (related #1587998)- Revert two high keycode mappings, xkbcomp fails to parse those. (#1587998)- xkeyboard-config 2.24- Fix typo in polish keyboard layout - xkeyboard-config 2.23.1 - use autosetup- xkeyboard-config 2.23- xkeyboard-config 2.22- Fix typo in tel-salara (#1469407)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- xkeyboard-config 2.21- Add evdev mappings for KEY_SOUND, KEY_UWB, KEY_WWAN and KEY_RFKILL- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Add BuildRequires: git- xkeyboard-config 2.20- Bump to keep F25 upgrade path happy, no changes.- xkeyboard-config 2.19- xkeyboard-config 2.18- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- xkeyboard-config 2.17- s/define/global/- Add br(thinkpad) to the xml file (#1292881)- xkeyboard-config 2.16- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- xkeyboard-config 2.15- xkeyboard-config 2.14- Add U+05BA (point holam haser for vav) on il(biblical) (#1132511)- Clean up SPEC file, fix rpmlint warnings. - Remove non-valid configure option.- xkeyboard-config 2.13- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- xkeyboard-config 2.12- xkeyboard-config 2.11- xkeyboard-config 2.20.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Fix changelog - percent sign needs to be escaped- Fix up three bogus changelog dates- xkeyboard-config 2.9- Add upstream patches for OLPC mechanical keyboard support- Fix a bunch of language codes (#952510, #952519)- xkeyboard-config 2.8- Fix Mali layout previously mapped to in(mal) (#647433)- Rebuild with fixed xkbcomp, re-create the right directory listing (not that anyone actually uses it)- Fix {?dist} tag- xkeyboard-config 2.7- Rebuilt for https://fxXLر $@$4$@#@%@-5David Kaspar [Dee'Kej] - 20170801-4David Kaspar [Dee'Kej] 20170801-3David Kaspar [Dee'Kej] - 20170801-2David Kaspar [Dee'Kej] - 20170801-1David Kaspar [Dee'Kej] - 20160926-1- fc-cache call dropped (from scriptlets)- *-legacy subpackage introduced (temporary workaround for BZ #1551219)- copy-paste error fixed in de.urwpp.URWCoreFontSetLevel2.metainfo.xml file- added %check section for validation of AppStream files- temporary workaround for BZ #1534206- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- added missing Obsoletes/Provides for *-nimbus-sans-narrow subpackage- *-devel subpackage added - typos & syntax fixed for AppStream files - NimbusSansNarrow-BdOblique.* renamed to *-BoldOblique - *-nimbus-sans-narrow subpackage dropped - priority/ordering decreased [60->61] - ship *.otf format files as well- urw-base35-fonts-20170801-000-split-urw-fallback.patch added - decrease the fontconfig priority/ordering value to 60 (bug #1494850) - set same priority value for urw-fallback.conf as for other files (bug #1495199)- rebase to 20170801 version - removed urw-* string from subpackages - fontconfig priority value updated to 35 - error messages from 'xset fp rehash' suppressed (bug #1466254) - AppStream files added into (sub)packages - fontconfig files added into (sub)packages - fixed fonts path during %install - source location updated to point at github.com- %description line in 'fontfamily_subpkg' macro split - requirement for 'fontpackages-filesystem' added - mark 'font.dir' and 'font.scale' as %ghost files - fix the upgrading process (for Obsoletes|Provides|Conflicts) - simplify creation of the subpackages with auxiliary %fontfamily_subpkg macro - update the fontconfig cache and X11 Logical Font Description database (during install/update/erase) - initial version of specfile created/bin/sh/bin/sh20170801-10.el861-urw-standard-symbols-ps.confde.urwpp.StandardSymbolsPS.metainfo.xml61-urw-standard-symbols-ps.confStandardSymbolsPS.afmStandardSymbolsPS.t1/etc/fonts/conf.d//usr/share/appdata//usr/share/fontconfig/conf.avail//usr/share/fonts/urw-base35/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m32 -march=x86-64 -mtune=generic -mfpmath=sse -mstackrealign -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuXML 1.0 document, ASCII textASCII font metricsPostScript Type 1 font text (StandardSymbolsPS 2.00)PPP ( if [[ -x /var/lib/rpm-state/urw-base35-fonts/cache-update-needed ]]; then # mkfontscale /usr/share/fonts/urw-base35 # mkfontdir /usr/share/fonts/urw-base35 # export DISPLAY=:0 # xset fp rehash &> /dev/null || : # true || : rm -rf /var/lib/rpm-state/urw-base35-fonts fi )/bin/shutf-8bbd348ce68993e8b09d54e55efa3f7ef5473484468ca4079e55c3a83331fe60d?` Qd~@ HjaeA;cs]?,3ـ|Ѧ>v.]w. U>x6 ` 6eH1Yjyҵ9ܧΦU&ssi'>F{`<5dUuq dWIF<($:Sr}5y_JΟ<1K :-6ѐ|5bۗ- \ g]ed[\_Rw+ד5I<}f[ˎ#r*/Dٕa'U\\"i_a}0{ csqaj7YSۤ{b|demHA7h^UA`>ǥv^p!Y|rbXL!|bᲳLT!ˉ` Qd~} m·p%j?ʻST\%P/R!^3 GLR &*(Xm{,6u7 }M? O#w[aBB 'ޅ$`W Ax0XvLxX$hole list of installed packages with glob pattern (RhBug:1163063) (Michal Luscon) - cli: _process_demands() does not respect --caheonly (RhBug:1151854) (Michal Luscon) - new authors added (Jan Silhan) - install: allow installation of provides with glob (Related:RhBug:1148353) (Michal Luscon) - tests: removed mock patch for _, P_ (Jan Silhan) - fixed error summary traceback (RhBug:1151740) (Jan Silhan) - doc: swap command alternative mentioned (RhBug:1110780) (Jan Silhan) - base: package_reinstall works only with the same package versions (Jan Silhan) - base: package_install allows install different arch of installed package (Jan Silhan) - base: package_downgrade prints message on failure (Jan Silhan) - base: package_upgrade does not reinstall or downgrade (RhBug:1149972) (Jan Silhan) - groups: searches also within localized names (RhBug:1150474) (Jan Silhan) - Run tests with C locales. (Daniel Mach) - Adds new motd emitter for dnf-automatic (RhBug:995537) (Kushal Das) - Fix wrong cache directory path used to clean up binary cache (Satoshi Matsumoto) - fix: traceback in history info (RhBug: 1149952) (Tim Lauridsen) - logging: added logrotate script for hawkey.log (RhBug:1149350) (Jan Silhan) - output: renamed displayPkgsInGroups (Jan Silhan) - logging: renamed log files (RhBug:1074715)" (Jan Silhan) - comps: Environment differentiates optional and mandatory groups (Jan Silhan) - group info handles environments (RhBug:1147523) (Jan Silhan) - deltarpm enabled by default (RhBug:1148208) (Jan Silhan) - doc: deplist command (Jan Silhan) - doc: minor fixes + repo references changed (Jan Silhan) - spec: requires rpm-plugin-systemd-inhibit (RhBug:1109927) (Jan Silhan)- transifex update (Jan Silhan) - refactor: move MakeCacheCommand out into its own file. (Ales Kozumplik) - api: add dnf.cli.CliError. (Ales Kozumplik) - Update user_faq.rst (Stef Krie) - Make --refresh play nice with lazy commands. (Ales Kozumplik) - bash-completion: more faster completing install/remove (Igor Gnatenko) - bash-completion: complete 'clean|groups|repolist' using help (Igor Gnatenko) - Allow some commands to use stale metadata. (RhBug:909856) (Ales Kozumplik) - does not install new pkgs when updating from local pkgs (RhBug:1134893) (Jan Silhan) - doesn't upgrade packages by installing local packages (Related:RhBug:1138700) (Jan Silhan) - refactor: repo: separate concepts of 'expiry' and 'sync strategy'. (Ales Kozumplik) - fix: dnf.cli.util.* leaks file handles. (Ales Kozumplik) - remove: YumRPMTransError. (Ales Kozumplik) - rename: Base's runTransaction -> _run_transaction(). (Ales Kozumplik) - drop unused parameter of Base.verify_transaction(). (Ales Kozumplik) - bash-completion: new completion from scratch (RhBug:1070902) (Igor Gnatenko) - py3: add queue.Queue to pycomp. (Ales Kozumplik) - locking: store lockfiles with the resource they are locking. (RhBug:1124316) (Ales Kozumplik) - groups: marks reason 'group' for packages that have no record yet (RhBug:1136584) (Jan Silhan) - goal: renamed undefined name variable (Jan Silhan) - refactor: split out and clean up the erase command. (Ales Kozumplik) - py3: fix traceback in fmtColumns() on a non-subscriptable 'columns'. (Ales Kozumplik) - groups: allow erasing depending packages on remove (RhBug:1135861) (Ales Kozumplik) - history: fixed wrong set operation (RhBug:1136223) (Jan Silhan) - base: does not reinstall pkgs from local rpms with install command (RhBug:1122617) (Jan Silhan) - refactor: crypto: drop the integer keyid representation altogether. (Ales Kozumplik) - crypto: fix importing rpmfusion keys. (RhBug:1133830) (Ales Kozumplik) - refactor: crypto: Key is a class, not an "info" dict. (Ales Kozumplik) - repos: fix total downloaded size reporting for cached packages. (RhBug:1121184) (Ales Kozumplik)- packaging: add dnf-yum. (Ales Kozumplik) - cli: added plugins missing hint (RhBug:1132335) (Jan Silhan) - using ts.addReinstall for package reinstallation (RhBug:1071854) (Jan Silhan) - Add history redo command. (Radek Holy) - Add a TransactionConverter class. (RaxXxL E$ test: add updateinfo to the testing repository (Radek Holy) - test: support adding directory repos to Base stubs (Radek Holy) - test: really don't break other tests with the DRPM fixture (Radek Holy) - Load UpdateInfo.xml during the sack preparation. (Radek Holy) - Add Repo.updateinfo_fn. (Radek Holy) - lint: add Selector calls to false positives, it's a hawkey type. (Ales Kozumplik) - removed recursive calling of ucd in DownloadError (Jan Silhan) - does not throw error when selector is empty (RhBug:1127206) (Jan Silhan) - remove etc/version-groups.conf, not used. (Ales Kozumplik) - lint: dnf.conf.parser (Ales Kozumplik) - rename: dnf.conf.parser.varReplace()->substitute() (Ales Kozumplik) - pycomp: add urlparse/urllib.parser. (Ales Kozumplik) - move: dnf.yum.parser -> dnf.conf.parser. (Ales Kozumplik) - packaging: add dnf-automatic subpackage. (Ales Kozumplik) - doc: properly list the authors. (Ales Kozumplik) - automatic: add documentation, including dnf.automatic(8) man page. (Ales Kozumplik) - dnf-automatic: tool supplying the yum-cron functionality. (Ales Kozumplik) - doc: cosmetic: fixed indent in proxy directive (Jan Silhan) - include directive support added (RhBug:1055910) (Jan Silhan) - refactor: move MultiCallList to util. (Ales Kozumplik) - cli: do not output that extra starting newline in list_transaction(). (Ales Kozumplik) - refactor: extract CLI cachedir magic to cli.cachedir_fit. (Ales Kozumplik) - transifex update (Jan Silhan) - move: test_output to tests/cli. (Ales Kozumplik) - refactor: move Term into its own module. (Ales Kozumplik) - refactoring: cleanup and linting in dnf.exceptions. (Ales Kozumplik) - lint: test_cli.py (Ales Kozumplik) - lint: rudimentary cleanups in tests.support. (Ales Kozumplik) - refactor: loggers are module-level variables. (Ales Kozumplik) - groups: promote unknown-reason installed packages to 'group' on group install. (RhBug:1116666) (Ales Kozumplik) - c82267f refactoring droppped plugins.run_transaction(). (Ales Kozumplik) - cli: sort packages in the transaction summary. (Ales Kozumplik) - refactor: cli: massively simplify how errors are propagated from do_transaction(). (Ales Kozumplik) - groups: rearrange things in CLI so user has to confirm the group changes. (Ales Kozumplik) - groups: committing the persistor data should only happen at one place. (Ales Kozumplik) - groups: visualizing the groups transactions. (Ales Kozumplik) - Add dnf.util.get_in() to navigate nested dicts with sequences of keys. (Ales Kozumplik) - group persistor: generate diffs between old and new DBs. (Ales Kozumplik) - Better quoting in dnf_pylint. (Ales Kozumplik) - lint: logging.py. (Ales Kozumplik) - Do not print tracebacks to the tty on '-d 10' (RhBug:1118272) (Ales Kozumplik) - search: do not double-report no matches. (Ales Kozumplik) - refactor: move UpgradeToCommand to its own module. (Ales Kozumplik)- packaging: also add pyliblzma to BuildRequires. (Ales Kozumplik) - essential cleanup in dnf.yum.misc, removing a couple of functions too. (Ales Kozumplik) - remove: Base.findDeps and friends. (Ales Kozumplik) - Make pyliblzma a requriement. (RhBug:1123688) (Ales Kozumplik) - whole user name can contain non-ascii chars (RhBug:1121280) (Jan Silhan) - Straighten up the exceptions when getting a packages header. (RhBug:1122900) (Ales Kozumplik) - tests: refactor: rename test_resource_path() -> resource_path() and use it more. (Ales Kozumplik) - transifex update (Jan Silhan) - remove: conf.commands. (Ales Kozumplik) - proxy username and password, for both CLI and API. (RhBug:1120583) (Ales Kozumplik) - conf: only 'main' is a reserved section name. (Ales Kozumplik) - refactoring: cleanup a couple of lint warnings in base.py. (Ales Kozumplik) - refactoring: move repo reading implementation out of dnf.Base. (Ales Kozumplik) - refactor: repo_setopts is a CLI thing and doesn't belong to Base. (Ales Kozumplik) - refactor: move cleanup methods to dnf.cli.commands.clean. (Ales Kozumplik) - depsolving: doesn't install both architectures of pkg by filename (RhBug:1100946) (Jan Silx tXL(h 9$%999Nalin Dahyabhai 1.3.2-1Nalin Dahyabhai 1.3.1-12Elliot Lee 1.3.1-11.1Elliot Lee 1.3.1-11Nalin Dahyabhai 1.3.1-10Nalin Dahyabhai 1.3.1-9Nalin Dahyabhai 1.3.1-8Nalin Dahyabhai Nalin Dahyabhai 1.3.1-7Nalin Dahyabhai Nalin Dahyabhai 1.3.1-6Nalin Dahyabhai 1.3.1-5Nalin Dahyabhai Nalin Dahyabhai 1.3.1-4Dan Walsh 1.3.1-3Nalin Dahyabhai 1.3.1-2Nalin Dahyabhai 1.3.1-1Nalin Dahyabhai 1.3.1-0Nalin Dahyabhai 1.3-2Nalin Dahyabhai 1.3-1Nalin Dahyabhai 1.2.8-4Nalin Dahyabhai 1.3-0.beta.4Elliot Lee Jeremy Katz 1.2.8-2Nalin Dahyabhai 1.2.8-1Nalin Dahyabhai 1.2.7-14Nalin Dahyabhai 1.2.7-13Nalin Dahyabhai 1.2.7-12Nalin Dahyabhai 1.2.7-11Nalin Dahyabhai 1.2.7-10Nalin Dahyabhai 1.2.7-9Nalin Dahyabhai 1.2.7-8Nalin Dahyabhai Nalin Dahyabhai 1.2.7-7Tim Powers Nalin Dahyabhai 1.2.7-5Bill Nottingham 1.2.7-4Jeremy Katz 1.2.7-3Jakub Jelinek 1.2.7-2Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai 1.2.7-1Nalin Dahyabhai Nalin Dahyabhai 1.2.6-5Nalin Dahyabhai 1.2.6-4Nalin Dahyabhai 1.2.6-3Nalin Dahyabhai 1.2.6-2Nalin Dahyabhai 1.2.6-1Nalin Dahyabhai 1.2.5-7Nalin Dahyabhai 1.2.5-6Nalin Dahyabhai 1.2.5-5Jakub Jelinek 1.2.5-4Tim Powers Tim Powers Nalin Dahyabhai 1.2.5-1Nalin Dahyabhai 1.2.4-1Nalin Dahyabhai 1.2.3-5Florian La Roche Nalin Dahyabhai 1.2.3-3Nalin Dahyabhai 1.2.3-2Nalin Dahyabhai 1.2.3-1Nalin Dahyabhai 1.2.2-14Nalin Dahyabhai 1.2.2-13Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Elliot Lee Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Than Ngo Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Jeff Johnson Bill Nottingham Nalin Dahyabhai Prospector Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Unspecifiedhttps://github.com/SELinuxProject/selinuxlinuxnoarch;j 6FF~ K+P^{GLD*%K+~ 6}Yy_Y큤flKflJflJflKflKflKflKflJflJflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKflKc61012885a96effafb8769c969f35ec37872ed074064d0995ea76c8e32d71ab9234152c15144e8b3b5e90e8eed44fff0e31ed12e990d49f0e7640465b111575c844b4685bbf60db5307e65da5dabf0ad3cb90afd08c603457065fedac544a915a4e29fd1594e0cd9ef8cd9776b9d072960a6611cd97dd3504e1e38b137aea09a2e597617d3574ffa6170a269dd0985779328c70da1e0a1b9d3aa2878763bbbbd16e9aeb58eceda38e195943f857e5fae8b1020c2ca53436a721b9ba5173a996838f224aaf27e8d65383dd049a627d736aa7e0e7b1ca87d9d195d121ada07501bd1ef55d60a74c41aa75554ec1de60b9c91e087e853b622223df2f3f3c52df81d27a89f5eedcb8f4080b51a82caff3b29a0d5f34f7890a3c9a1d25e7f2d7fbb02d5fb0f8627d7fbe54fb11460ac269095cbdd0abe40e97bc07fd021ce84751961aeb111c2108ffab3b79fd434c7598c982118cafc3c3a2c6bce04bd0be513ec116ffdce7c8b9ffc53ab725b55a57793f19b88626b4cfb252d5cffc9cc95e8291973d0a63b829c8ad2f239f4061e24a746d56d5198571379337f21a32374103946b9171295c6bb04c84463b7dd35cbe4654a6cd540028162fae87903ebb419935e3dd3ec03497b3c8b988a877f04d4e6388138c377440c99afd36cc738ce5d00f8f3b4644255ad44f0cb1decf301ea8d395c6dd54c4a06b19f4dc464e5c055f397a73c0c4d2dc93b11cd24974c5d6ff90c4a64514a83ac4aad3cde618b9a6696cc8cbd0e0c9f562eb2f2f0275962c16aaaac6714819692e5f0d0e5bc20bc092ddada79b36299dcb2fe417f934771807db4f7be9cf87b188a0734ef0b4e0922cc55ad21bb972ccbc92f9f2f13109bb8572c040da7e07941ed08316a542355dee5359bbb06463629c56d25d5bd0e78050d988bb950e6a413bb79d0399823432c1691b62150c8260c6a87077985b07c9fa06d1f49ec01f1df8b58c2f15aab1fe3b03ca0fb61c37752cc4ebe51c47aaf58e548175d3e4484f25bb330ee75bb64cac09d0287fc24ca865eb65eb06b4dbcb91512015d97550b05a5188b167973b11400256a30a95d11eb49ed3a43f63cc28bc3a45443f84c7cb62833cefd3bcbddcf4bcc5888b162d2e935a53bfe5c1967f172822b9288eaed3f8d17ffc769a2fc9b23a7d1ef55d60a74c41aa75554ec1de60b9c91e087e853b622223df2f3f3c52df81d7809b9c675999043249bcfda1f42b921cc5b42932453a0a90aac2bbc55abc5059c7a1922d2eeb3a789f50dfe0ce025930ce69a1cfb66c7db9c153247567bc9ec8adfea0b38ef7ac2eff97124ab9e2d97d7351b1ef31c5294226cbeb18ced649899c3d53965dxHBXmLП}$m}|~mmand (Jaroslav Mracek) - bash_completion: use system-python if it's available (Igor Gnatenko) - spec: use system-python for dnf-yum as well (Igor Gnatenko) - comps/groups: fix tests (Michal Luscon) - comps: adjust group_upgrade to new CompsTransPkg style (Michal Luscon) - groups: refactored installation (RhBug:1337731, RhBug:1336879) (Michal Luscon) - Increase requirement for hawkey (Jaroslav Mracek) - Change reporting problems for downgradePkgs() (Jaroslav Mracek) - Use selector for base.package_upgrade() (Jaroslav Mracek) - Add usage of selectors for base.package_install() (Jaroslav Mracek) - Use selector for base.package_downgrade() (Jaroslav Mracek) - Redirect base.downgrade() to base.downgrade_to() (Jaroslav Mracek) - Enable wildcard for downgrade command (RhBug:1173349) (Jaroslav Mracek) - Refactor downgrade cmd behavior (RhBug:1329617)(RhBug:1283255) (Jaroslav Mracek) - Redirect logger.info into stderr for repolist (RhBug:1369411) (Jaroslav Mracek) - Redirect logger.info into stderr for repoquery (RhBug:1243393) (Jaroslav Mracek) - Add possibility for commands to redirect logger (Jaroslav Mracek) - Put information about metadata expiration into stdout (Jaroslav Mracek) - Change warning about added repo into info (RhBug:1243393) (Jaroslav Mracek) - Move grouplist output from logger into stdout (Jaroslav Mracek) - let repo exclude work the same way as global exclude (Michael Mraka) - Fix wrong assumptions about metalinks (RhBug:1411349) (Jaroslav Mracek) - handle --disablerepo/--enablerepo properly with strict (RhBug:1345976) (Štěpán Smetana) - Add fix to notify user about no repos (RhBug:1369212) (Abhijeet Kasurde) - Add information about "hidden" option in dnf doc (RhBug:1349247) (Abhijeet Kasurde) - Fix for 'history package-list' (Amit Upadhye) - Enable multiple args for repoquery -f (RhBug:1403930) (Jaroslav Mracek) - Set default repo.name as repo._section (Jaroslav Mracek) - Create from self.forms value forms in cmd.run() (Jaroslav Mracek) - Add description of swap command into documentation (Jaroslav Mracek) - Add swap command (RhBug:1403465) (RhBug:1110780) (Jaroslav Mracek) - Solve a problem with shell when empty line or EOF (Jaroslav Mracek) - shell: add history of commands (RhBug:1405333) (Michal Luscon) - Add info if no files with repoquery -l (RhBug:1254879) (Jaroslav Mracek) - po: update translations (Igor Gnatenko) - po: migrate to zanata python client and trivial fixes in build (Igor Gnatenko) - po: include all possible languages from zanata (Igor Gnatenko) - po: include comments for translations (Igor Gnatenko) - shell: catch exceptions from depsolving (Michal Luscon) - shell: update documentation (Michal Luscon) - shell: add transaction reset cmd (Michal Luscon) - shell: add transaction resolve cmd (Michal Luscon) - shell: provide rewritable demands for cmds (Michal Luscon) - shell: catch tracebacks from shlex (Michal Luscon) - shell: handle ctrl+D more gracefully (Michal Luscon) - groups: set demands in configure instead of run (Michal Luscon) - shell: implement config cmd (Michal Luscon) - shell: add help (Michal Luscon) - shell: make alias repo list -> repolist (Michal Luscon) - shell: catch exceptions from do_transaction (Michal Luscon) - shell: resolve transaction in ts run (Michal Luscon) - shell: add default value for internal methods argument (Michal Luscon) - shell: create run alias for ts run (Michal Luscon) - shell: add ts list cmd (Michal Luscon) - shell: refill sack after every successful repo cmd (Michal Luscon) - shell: allow running multiple transaction in one session (Michal Luscon) - shell: add ts command (Michal Luscon) - shell: catch cmd parsing and run exceptions (Michal Luscon) - shell: allow to run scripts (Michal Luscon) - shell: add repo cmd (Michal Luscon) - shell: add resolving + transaction run support (Michal Luscon) - shell: implement quit method (Michal Luscon) - shell: add custom cmds stubs (Michal Luscon) - shell: implement basic logic (Michal Luscon) - shell: register new cmd (Michal Luscon)- tests: catch ModuleNotFoundx1X"L0H$Giarik - 1.6.1-1Joe Orton - 1.6.0-1Fedora Release Engineering - 1.5.4-7Fedora Release Engineering - 1.5.4-6Fedora Release Engineering - 1.5.4-5Joe Orton - 1.5.4-4Fedora Release Engineering - 1.5.4-3Fedora Release Engineering - 1.5.4-2Jan Kaluza - 1.5.4-1Fedora Release Engineering - 1.5.3-3Fedora Release Engineering - 1.5.3-2Joe Orton - 1.5.3-1Fedora Release Engineering - 1.5.2-4Jan Kaluza - 1.5.2-3Joe Orton - 1.5.2-2Joe Orton - 1.5.2-1Jon Ciesla - 1.4.1-8Jan Kaluza - 1.4.1-7Joe Orton - 1.4.1-6Fedora Release Engineering - 1.4.1-5Joe Orton - 1.4.1-4Joe Orton - 1.4.1-3Joe Orton - 1.4.1-2Fedora Release Engineering - 1.4.1-2Bojan Smojver - 1.4.1-1Bojan Smojver - 1.3.12-1Bojan Smojver - 1.3.11-2Bojan Smojver - 1.3.11-1Dan Horák - 1.3.10-7Joe Orton - 1.3.10-6Joe Orton - 1.3.10-5Joe Orton - 1.3.10-4Fedora Release Engineering - 1.3.10-3Bojan Smojver - 1.3.10-2Joe Orton - 1.3.10-1Joe Orton - 1.3.9-3Tomas Mraz - 1.3.9-2Bojan Smojver - 1.3.9-1Fedora Release Engineering - 1.3.8-3Bojan Smojver 1.3.8-2Bojan Smojver 1.3.8-1Bojan Smojver 1.3.7-5Joe Orton 1.3.7-4Bojan Smojver - 1.3.7-3Bojan Smojver - 1.3.7-2Bojan Smojver - 1.3.7-1Fedora Release Engineering - 1.3.4-3Joe Orton 1.3.4-2Bojan Smojver - 1.3.4-1Bojan Smojver - 1.3.2-8Bojan Smojver - 1.3.2-7Tom "spot" Callaway 1.3.2-6Joe Orton 1.3.2-5Bojan Smojver - 1.3.2-4Bojan Smojver - 1.3.2-3Bojan Smojver - 1.3.2-2Bojan Smojver - 1.3.2-1Bojan Smojver - 1.3.0-1Fedora Release Engineering - 1.2.12-5Joe Orton 1.2.12-4Bojan Smojver - 1.2.12-3Bojan Smojver - 1.2.12-1Jesse Keating - 1.2.10-2Bojan Smojver 1.2.10-1Joe Orton 1.2.8-12Joe Orton 1.2.8-11Joe Orton 1.2.8-10Joe Orton 1.2.8-9Joe Orton 1.2.8-8Joe Orton 1.2.8-7Joe Orton 1.2.8-6Joe Orton 1.2.8-5Joe Orton 1.2.8-4Joe Orton 1.2.8-3Joe Orton 1.2.8-2Joe Orton 1.2.7-5Joe Orton 1.2.7-4Joe Orton 1.2.7-3Jesse Keating - 1.2.7-2.1Joe Orton 1.2.7-2Joe Orton 1.2.6-2Jesse Keating - 1.2.2-4.2Jesse Keating - 1.2.2-4.1Joe Orton 1.2.2-4Joe Orton 1.2.2-3Jesse Keating 1.2.2-2.2Jesse Keating Joe Orton 1.2.2-2Jx$8!X9L=$tr Lautrbach 2.3-16Petr Lautrbach 2.3-15Dan Walsh - 2.3-14Miroslav Grepl - 2.3-13Miroslav Grepl - 2.3-12Miroslav Grepl - 2.3-11Fedora Release Engineering - 2.3-10Dan Walsh - 2.3-9Tom Callaway - 2.3-8Miroslav Grepl - 2.3-7Fedora Release Engineering - 2.3-6Kalev Lember - 2.3-5Miroslav Grepl - 2.3-4Dan Walsh - 2.3-3Miroslav Grepl - 2.3-2Dan Walsh - 2.3-1Miroslav Grepl - 2.2.5-15Dan Walsh - 2.2.5-14Miroslav Grepl - 2.2.5-13Miroslav Grepl - 2.2.5-12Dan Walsh - 2.2.5-11Miroslav Grepl - 2.2.5-10Dan Walsh - 2.2.5-9Dan Walsh - 2.2.5-8Dan Walsh - 2.2.5-7Dan Walsh - 2.2.5-6Dan Walsh - 2.2.5-5Dan Walsh - 2.2.5-4Dan Walsh - 2.2.5-3Dan Walsh - 2.2.5-2Dan Walsh - 2.2.5-1Dan Walsh - 2.2.4-8Dan Walsh - 2.2.4-7Dan Walsh - 2.2.4-6Dan Walsh - 2.2.4-5Dan Walsh - 2.2.4-4Dan Walsh - 2.2.4-3Dan Walsh - 2.2.4-2Dan Walsh - 2.2.4-1Dan Walsh - 2.2.3-1Dan Walsh - 2.2.2-2Dan Walsh - 2.2.2-1Dan Walsh - 2.2-2Dan Walsh - 2.2-1Dan Walsh - 2.1.14-89Dan Walsh - 2.1.14-88Dan Walsh - 2.1.14-87Dan Walsh - 2.1.14-86Dan Walsh - 2.1.14-85Dan Walsh - 2.1.14-84Dan Walsh - 2.1.14-83Dan Walsh - 2.1.14-82Dan Walsh - 2.1.14-81Dan Walsh - 2.1.14-80Dan Walsh - 2.1.14-79Dan Walsh - 2.1.14-78Dan Walsh - 2.1.14-77Dan Walsh - 2.1.14-76Dan Walsh - 2.1.14-75Dan Walsh - 2.1.14-74Dan Walsh - 2.1.14-73Dan Walsh - 2.1.14-72Dan Walsh - 2.1.14-71Dan Walsh - 2.1.14-70Dan Walsh - 2.1.14-69Dan Walsh - 2.1.14-68Dan Walsh - 2.1.14-67Dan Walsh - 2.1.14-66Dan Walsh - 2.1.14-65Dan Walsh - 2.1.14-64Dan Walsh - 2.1.14-63Dan Walsh - 2.1.14-62Dan Walsh - 2.1.14-61Dan Walsh - 2.1.14-60Dan Walsh - 2.1.14-59Dan Walsh - 2.1.14-58Dan Walsh - 2.1.14-57Dan Walsh - 2.1.14-56Dan Walsh - 2.1.14-55Dan Walsh - 2.1.14-54Dan Walsh - 2.1.14-53Dan Walsh - 2.1.14-52Dan Walsh - 2.1.14-51Dan Walsh - 2.1.14-50Dan Walsh - 2.1.14-49Dan Walsh - 2.1.14-48Dan Walsh - 2.1.14-47Dan Walsh - 2.1.14-46Dan Walsh - 2.1.14-45Dan Walsh - 2.1.14-44Dan Walsh - 2.1.14-43Dan Walsh - 2.1.14-42Dan Walsh - 2.1.14-41Dan Walsh - 2.1.14-40Dan Walsh - 2.1.14-39Dan Walsh - 2.1.14-38Dan Walsh <xXL&VI$FVIUIE?d" . ] 4:D t          \   8 hw(89 : BG H I XY$ZT[X\` ] ^_bde flt( uX v  A ghCcpanel-mariadb-connector3.3.152.cp130~el8A Client Library for connecting to MariaDB 5.5The MariaDB Client Library for C is used to connect applications developed in C/C++ to MariaDB and MySQL databases.The client library is LGPL licensed. Parts of the MariaDB Client Library for C are derived from PHPs mysqlnd extension (http://www.php.net and the original LGPL MySQL client library for MySqL 3.23. The rest of the code is written by developers at Monty Program Ab.hHYbh-centos-8.dev.cpanel.net LGPLApplications/Databaseshttp://www.mariadb.org/linuxx86_643 88*3(54p!hHXhHYhHXhHXhHYhHYhHYhHYhHYhHYhHYhHYba459793643c27f07f7a651895a603dbb5f739767dfd782ddae9bceb11c5c1d71428d84037c83a6b7b8c1a14e0222dc2f580263d68a1832415ea0df447bdaeb554a46e3b12012e7c22a67e3bfa1597858c682ab61e04089c20583e5b9164223a17977ff9f9b2f500b86ce27cf76a92e054af73699ae8a99e082dbf2e9f09280bb2e16ad8b63a531bb12b9d8c8794914a98d52b2d8d117afacd72a54f4c6d1ca79d31ffef6c44ca23fdd4b1dc3428140c82218f2d1f245e1577e50ef048e416a61f31809930e1a4b6a2b5090a303055c7c4921c485f5d42e68130c38aad8f6f751407de38a464d423775d53d22b53f51ab4a8e1df95d24a27b12b708b567c7d13d0f47b87fccb256cc26bfefa271227d39627952e7aab38bb28ba38fa5ee768b8libmariadb.so.3libmariadb.so.3libmariadb.so.3rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-mariadb-connector-3.3.15-2.cp130~el8.src.rpmcpanel-mariadb-connectorcpanel-mariadb-connector(x86-64)cpanel-mariadb-native-client     cpanel-perllibcurllibzstdrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-1cpanel-mariadb-native-client3.3.154.14.3hH@h,nggr@b'b'b(`8^V@^^FZ@Z@Z@Z@Todd Rinaldo - 3.3.15-2.cp130~el8Todd Rinaldo - 3.3.15-1.cp130Sloane Bernstein - 3.3.13-2.cp108Sloane Bernstein - 3.3.13-1.cp108Nicolas Rochelemagne - 3.3.1-1.cp108Nicolas Rochelemagne - 3.2.6-1.cp108Nicolas Rochelemagne - 3.2.6-1.cp1198Todd Rinaldo - 3.1.8-1.cp1198Chris Dillon - 3.1.8-2.cp1186Chris Dillon - 3.1.8-1.cp1186Thomas Baugh - 3.1.7-1.cp1186Nicolas Rochelemagne - 3.0.3-1.cp1186Nicolas Rochelemagne - 3.0.3-3.cp1174Nicolas Rochelemagne - 3.0.3-2.cp1174Nicolas Rochelemagnx(XL$Hoe Orton 1.2.2-1Joe Orton 0.9.7-3Joe Orton 0.9.7-2Joe Orton 0.9.6-3Joe Orton 0.9.6-2Joe Orton 0.9.6-1Joe Orton 0.9.5-3Joe Orton 0.9.5-2Joe Orton 0.9.5-1Jeff Johnson 0.9.4-19Jeff Johnson 0.9.4-18Joe Orton 0.9.4-17Joe Orton 0.9.4-16Elliot Lee Joe Orton 0.9.4-14Joe Orton 0.9.4-13Joe Orton 0.9.4-12Joe Orton 0.9.4-11Elliot Lee 0.9.4-10.1Joe Orton 0.9.4-10Joe Orton 0.9.4-9Elliot Lee 0.9.4-8Joe Orton 0.9.4-7Joe Orton 0.9.4-6Joe Orton 0.9.4-5Jeff Johnson 0.9.4-4Jeff Johnson 0.9.4-3Joe Orton 0.9.4-2Joe Orton 0.9.4-1Nalin Dahyabhai 0.9.3-10Joe Orton 0.9.3-9Joe Orton 0.9.3-8Elliot Lee Joe Orton 0.9.3-6Joe Orton 0.9.3-5Joe Orton 0.9.3-4Joe Orton 0.9.3-3Joe Orton 0.9.3-2Joe Orton 0.9.3-1- Related: #2063562 - mod_auth_openidc fails with IPv6 OIDCMemCacheServers- Resolves: #2063562 - mod_auth_openidc fails with IPv6 OIDCMemCacheServers- Resolves: #2196573 - CVE-2022-25147 apr-util: out-of-bounds writes in the apr_base64- Recommends: apr-util-openssl, apr-util-bdb (#1633973)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuild with new build flags embedded in apr- Rebuilt for switch to libxcrypt- Build with mariadb-connector-c- new version 1.6.1- update to 1.6.0 (#1460831) - move bdb support to loadable DSO in apr-util-dbd subpackage - drop NSS, freetds support- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- update for OpenSSL 1.1.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- update to 1.5.4- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- update to 1.5.3- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- do not build with freetds when it is not available- update for aarch64- update to 1.5.2- Apply private patch from Merge Review BZ 225254.- ensure we use latest libdb5 (not libdb4)- use -lldap_r instead of -lldap- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- fix crypt_r failure modes (#819650)- apply _isa to deps- switch to libdb-devel- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- bump up to 1.4.1- bump up to 1.3.12- fix crash in apr_ldap_rebind_init()- bump up to 1.3.11- rebuilt for mysql 5.5.10 (soname bump in libmysqlclient)- rebuild for MySQL soname bump- fix build- rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- rebuild for MySQL 5.5.x- update to 1.3.10- rebuild for new BDB- rebuilt with new openssl- bump up to 1.3.9 - CVE-2009-2412 - allocator alignment fixes- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- adjust apr-util-1.3.7-nodbmdso.patch- bump up to 1.3.8- BR: +libuuid-devel, -e2fsprogs-devel- disable DBM-drivers-as-DSO support - backport r783046 from upstream- make export of LD_LIBRARY_PATH simpler- revert tests- bump up to 1.3.7 - CVE-2009-0023 - "billion laughs" fix of apr_xml_* interface- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild for new MySQL- bump up to 1.3.4 -x&p<<<`   ` X " \uP Providename 8.0.8-1Travis Holloway - 8.0.7-2Cory McIXRL:T$.TTTo --panic-on/off (RHBZ#874912) - Fix interaction problem of changed event of gtk combobox with polkit-kde by processing all remaining events (RHBZ#915892) - Stop default zone rules being applied to all zones (RHBZ#912782) - Firewall.start(): don't call set_default_zone() - Add wiki's URL to firewalld(1) and firewall-cmd(1) man pages - firewalld-cmd: make --state verbose (RHBZ#886484) - improve firewalld --help (RHBZ#910492) - firewall-cmd: --add/remove-* can be used multiple times (RHBZ#879834) - Continue loading zone in case of wrong service/port etc. (RHBZ#909466) - Check also services and icmptypes in Zone() (RHBZ#909466) - Increase the maximum length of the port forwarding fields from 5 to 11 in firewall-config - firewall-cmd: add usage to fail message - firewall-cmd: redefine usage to point to man page - firewall-cmd: fix visible problems with arg. parsing - Use argparse module for parsing command line options and arguments - firewall-cmd.1: better clarify where to find ACTIONs - firewall-cmd Bash completion - firewall-cmd.1: comment --zone= usage and move some options - Use zone's target only in %s_ZONES chains - default zone in firewalld.conf was set to public with every restart (#902845) - man page cleanup - code cleanup- Another fix for RHBZ#912782- Stop default zone rules being applied to all zones (RHBZ#912782)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Default zone in firewalld.conf was reseted with every restart (RHBZ#902845) - Add icon cache related scriptlets for firewall-config (RHBZ#902680) - Fix typo in firewall-config (RHBZ#895812) - Fix few mistakes in firewall-cmd(1) man page- firewall-cmd: use -V instead of -v for version info (RHBZ#886477) - firewall-cmd: don't check reload()'s return value (RHBZ#886461) - actually install firewalld.zones.5 - firewall-config: treat exceptions when adding new zone/service/icmp (RHBZ#886602) - firewalld.spec: Fixed requirements of firewall-config to use gtk2 and pygobject3 - Fail gracefully when running in non X environment.(RHBZ#886551) - offline-cmd: fail gracefully when no s-c-f config - fix duplicated iptables rules (RHBZ#886515) - detect errors and duplicates in config file (RHBZ#886581) - firewall-config: don't make 'Edit Service' and 'Edit ICMP Type' insensitive - firewalld.spec: fixed requirements, require pygobject3-base - frewall-applet: Unused code cleanup - firewall-applet: several usability fixes and enhancements (RHBZ#886531) (RHBZ#886534) - firewall/server/server.py: fixed KeyboardInterrupt message (RHBZ#886558) - Moved fallback zone and minimal_mark to firewall.config.__init__ - Do not raise ZONE_ALREADY_SET in change_zone if old zone is set again (RHBZ#886432) - Make default zone default for all unset connections/interfaces (RHBZ#888288) (RHBZ#882736) - firewall-config: Use Gtk.MessageType.WARNING for warning dialog - firewall-config: Handle unknown services and icmptypes in persistent mode - firewall-config: Do not load settings more than once - firewall-config: UI cleanup and fixes (RHBZ#888242) - firewall-cmd: created alias --change-zone for --change-interface - firewall-cmd man page updates (RHBZ#806511) - Merged branch 'build-cleanups' - dropped call to autogen.sh in build stage, not needed anymore due to 'build-cleanups' merge- require pygobject3-base instead of pygobject3 (no cairo needed) (RHBZ#874378) - fixed dependencies of firewall-config to use gtk3 with pygobject3-base and not pygtk2- Fixed more _xmlplus (PyXML) incompatibilities to python xml - Several man page updates - Fixed error in addForwardPort, removeForwardPort and queryForwardPort - firewall-cmd: use already existing queryForwardPort() - Update firewall.cmd man page, use man page as firewall-cmd usage (rhbz#876394) - firewall-config: Do not force to show labels in the main toolbar - firewall-config: Dropped "Change default zone" from toolbar - firewall-config: Added menu entry to change zones of connections - firewall-applet: Zones can be changed now using nm-connection-editor (rhbz#876661) - x8X5L&!$z!!FP?|d ( h $, 0 4 <   8L(89l:jFGHIXY\]^b.c~defltuvz,06x  <@DgHhLCea-php-cli-lsphp1.0.012.20.1.cpanelExecute the correct lsphp binary for the configured PHP versionLSAPI PHP wrappers to dispatch to the user's configured version of php.j @ - 1.0.0-12Sloane Bernstein - 1.0.0-11Brian Mendoza - 1.0.0-10Tim Mullin - 1.0.0-9Tim Mullin - 1.0.0-8Tim Mullin - 1.0.0-7Daniel Muey - 1.0.0-6Tim Mullin - 1.0.0-5Daniel Muey - 1.0.0-4Daniel Muey - 1.0.0-3Daniel Muey - 1.0.0-2Daniel Muey - 1.0.0-1Rikus Goodell - 0.2.1-1Cory McIntire - 0.2.0-7Dan Muey - 0.2.0-6Dan Muey - 0.2.0-5Dan Muey - 0.2.0-4Edwin Buck - 0.2.0-1Edwin Buck - 0.1.0-2Edwin Buck - 0.1.0-1Jacob Perkins - 0.0.6-5Dan Muey - 0.0.6-4Dan Muey - 0.0.6-3S. Kurt Newman - 0.0.6-1Julian BRown - 0.0.5-1Matt Dees - 0.0.4-1Julian Brown - 0.0.3-1Julian Brown - 0.0.2-2Julian Brown - 0.0.1-2Julian Brown - 0.0.1-1- ZC-12720: Add a placebo version of /usr/local/bin/pear- ZC-11159: Invalidate/don't use cache if environment variable is passed- ZC-10936: Clean up Makefile and remove debug-package-nil- EA-7961: Remove deprecated -ea_php flag- EA-8537: Fix php version detection when cwd is a symlink- EA-8257: Fix warning when PWD environment variable not set- ZC-4806: Smarter handling of paths containing symlinks- EA-8227: Fix _lookup_pkg_for_path to handle multiple consecutive slashes- ZC-4712: Move cache into ~/.cpanel/- ZC-4580: handle two minor edge cases- ZC-4459: Cache the calculated PHP version for a given directory- ZC-4400: rewrite to make it easier to work with and fix all the bugs - ZC-4425: deprecate -ea_php flag- EA-7935: Add support for -ea_reference_dir option.- EAxȔXKsLH$ence to bug reporting guide (Jan Silhan) - test: ignore user terminal width (Jan Silhan) - cosmetic: base: import dnf.util.first (Jan Silhan) - base.upgrade: inform user when pkg not installed and skipped (RhBug:1187741) (Jan Silhan) - disable buildtime c/c++ dependency (Michael Mraka) - doc: document the new virtual provides (Radek Holy) - AUTHORS: updated (Jan Silhan) - AUTHORS: distuinguish authors and contributors (Jan Silhan) - Create ka.po (George Machitidze) - Parser: fix path handling (Haikel Guemar) - doc: metadata_timer_sync checked every hour (Jan Silhan)- doc: release notes dnf-1.0.0 (Michal Luscon) - completion: don't do aliases (RhBug:1215289) (Jan Silhan) - use Sack.load_repo() instead of Sack.load_yum_repo() (Jan Silhan) - Repo.name has default value of repo ID (RhBug:1215560) (Jan Silhan) - cosmetic: get rid of user visible yum references (Jan Silhan) - moved install_or_skip to dnf.comps (Jan Silhan) - group: see already installed group during installation (RhBug:1199648) (Jan Silhan) - group: install_or_skip returns num of packages to install (Jan Silhan) - group: made global function install_or_skip (Jan Silhan) - AUTHORS: updated (Radek Holy) - describe --refresh option in --help output (Pádraig Brady) - better no such command message (RhBug:1208773) (Jan Silhan) - doc: package-cleanup example doesn't print 'No match for argument:...' garbage (Jan Silhan) - mention yum check replacement (Michael Mraka) - added ref to dnf list (Michael Mraka) - added package-cleanup to dnf translation table (Michael Mraka) - python3: Repo comparison (RhBug:1208018) (Jan Silhan) - python3: YumHistoryRpmdbProblem comparison (RhBug:1207861) (Jan Silhan) - python3: YumHistoryTransaction comparison (Jan Silhan) - tests: use packages in test_transaction (Radek Holy) - cosmetic: fix some Pylint errors (Radek Holy) - updated documentation wrt installonlypkgs and auto removal (Michael Mraka) - mark installonly packages always as userinstalled (RhBug:1201445) (Michael Mraka) - mark username/password as api (Michael Mraka) - document username/password repo attributes (Michael Mraka) - support HTTP basic auth (RhBug:1210275) (Michael Mraka) - cli: better metadata timestamp info (Michal Luscon) - repo: add metadata mirror failure callback (Michal Luscon) - dnf-yum: cosmetic: lower case after comma (Jan Silhan) - dnf-yum: print how to install migrate plugin (Jan Silhan) - doc: show the real package for each tool in dnf-plugins-extras (Tim Lauridsen) - doc: improve the documentation of repo costs (Radek Holy) - doc: fix debuginfo-install package name (Michal Luscon) - doc: release notes 0.6.5 (Michal Luscon) - bash-completion: allow only one subcmd for help (Igor Gnatenko) - bash-completion: add history completion (Igor Gnatenko) - bash-completion: add completion for help (Igor Gnatenko) - bash-completion: check where pointing bin/dnf (Igor Gnatenko) - bash-completion: implement completion for clean cmd (Igor Gnatenko) - bash_completion: implement downgrade command (Igor Gnatenko) - bash-completion: refactor to python helper (Igor Gnatenko) - command downgrade does downgrade_to (RhBug:1191275) (Jan Silhan) - AUTHORS: updated (Jan Silhan) - clean: 'dnf clean all' should also clean presto and updateinfo solvx files (Parag Nemade) - dnf-yum: modified warning message (RhBug:1207965) (Jan Silhan)- subject: expand every glob name only once (RhBug:1203151) (Michal Luscon) - group mark: skips already installed groups (Jan Silhan) - Merge pull request #246 from mluscon/yum2dnf (mluscon) - Add yum2dnf man page (Michal Luscon) - doc: extend cli_vs_yum (Michal Luscon) - dnf-yum package does not conflict with yum 3.4.3-505+ (Jan Silhan) - fixed double set of demand from 0e4276f (Jan Silhan) - group: remove cmd don't load available_repos, see 04da412 (Jan Silhan) - spec: /var/lib/dnf owned by dnf-conf (Jan Silhan) - spec: apply the weak dependencies only on F21+ (Radek Holy) - dnf-automatic: fixed python_sitelib (RhBug:1199450) (Jan Silhan) - Add release instructions (Michal Luscon) - setup tito to bump verx(XL @ 8$(879MMM)MM@M@M@M@MTM_MQ0@MA^@M@ M@ M>@M=iMMLL7L@L@L@LdL@L@L@L{LA@L)@L)@L)@L)@Lk@LMxL>@L9@L7@L5L(LKK.KыKŮ@KŮ@K"@KrK!@K@K@K@KKl@K0K/c@K+nK+nK@K@K@K@KVK@KK JęJęJ@Ju@JJ@JrJn@JmJjJW-@JS8JS8J,@J'@J&eI4I@@I@@I̿I@IyIIIV@I@IU@IU@IwI1Itk@IO@IBR@I/@I*@Ig@HHO@Hf@Hf@H@HϟH@HH@HHz@HuHt@Hl@Hj@Hd@H`HO@HNlHI&H:@H5`@H1kH.G߮G߮G߮G߮G߮GGGG.@G.@G.@G.@G.@G@GGfGfGG@GeGNJitka Plesnikova - 4:5.26.3-423Jitka Plesnikova - 4:5.26.3-422Jitka Plesnikova - 4:5.26.3-421Jitka Plesnikova - 4:5.26.3-420Jitka Plesnikova - 4:5.26.3-419Petr Pisar - 4:5.26.3-418Jitka Plesnikova - 4:5.26.3-417Jitka Plesnikova - 4:5.26.3-416Petr Pisar - 4:5.26.2-415Jitka Plesnikova - 4:5.26.2-414Petr Pisar - 4:5.26.2-413Petr Pisar - 4:5.26.2-412Jitka Plesnikova - 4:5.26.2-411Petr Pisar - 4:5.26.2-410Florian Weimer - 4:5.26.1-409Igor Gnatenko - 4:5.26.1-408Petr Pisar - 4:5.26.1-407Petr Pisar - 4:5.26.1-406Petr Pisar - 4:5.26.1-405Björn Esser - 4:5.26.1-404Petr Pisar - 4:5.26.1-403Petr Pisar - 4:5.26.1-402Jitka Plesnikova - 4:5.26.1-401Jitka Plesnikova - 4:5.26.1-400Petr Pisar - 4:5.26.0-399Petr Pisar - 4:5.26.0-398Igor Gnatenko - 4:5.26.0-397Fedora Release Engineering - 4:5.26.0-396Petr Pisar - 4:5.26.0-395Petr Pisar - 4:5.26.0-394Jitka Plesnikova - 4:5.26.0-393Jitka Plesnikova - 4:5.26.0-392Petr Pisar - 4:5.24.1-391Petr Pisar - 4:5.24.1-390Petr Pisar - 4:5.24.1-389Petr Pisar - 4:5.24.1-388Petr Pisar - 4:5.24.1-387Petr Pisar - 4:5.24.1-386Jitka Plesnikova - 4:5.24.1-385Igor Gnatenko - 4:5.24.0-384Petr Pisar - 4:5.24.0-383Petr Pisar - 4:5.24.0-382Petr Pisar - 4:5.24.0-381Petr Pisar - 4:5.24.0-380Petr Pisar - 4:5.24.0-379Petr Pisar - 4:5.24.0-378Jitka Plesnikova - 4:5.24.0-377Petr Pisar - 4:5.24.0-376Petr Pisar - 4:5.24.0-375Petr Pisar - 4:5.24.0-374Petr Pisar - 4:5.24.0-373Petr Pisar - 4:5.24.0-372Jitka Plesnikova - 4:5.24.0-371Petr Pisar - 4:5.24.0-370Petr Pisar - 4:5.24.0-369Petr Pisar - 4:5.24.0-368Petr Pisar - 4:5.24.0-367Petr Pisar - 4:5.24.0-366Petr Pisar - 4:5.24.0-365Petr Pisar - 4:5.24.0-364Jitka Plesnikova - 4:5.24.0-363Jitka Plesnikova - 4:5.24.0-362Jitka Plesnikova - 4:5.22.6-361Petr Pisar - 4:5.22.1-360Petr Pisar - 4:5.22.1-359Petr Pisar - 4:5.22.1-358Petr Pisar - 4:5.22.1-357Fedora Release Engineering - 4:5.22.1-356Petr Pisar - 4:5.22.1-355Jitka Plesnikova - 5.22.1-35xXL9$?999t.com> - 1.16.1-11Robbie Harwood - 1.16.1-10Robbie Harwood - 1.16.1-9Robbie Harwood - 1.16.1-8Robbie Harwood - 1.16.1-7Robbie Harwood - 1.16.1-6Robbie Harwood - 1.16.1-5Robbie Harwood - 1.16.1-4Robbie Harwood - 1.16.1-3Robbie Harwood - 1.16.1-2Robbie Harwood - 1.16.1-1Robbie Harwood - 1.16-27Robbie Harwood - 1.16-26Robbie Harwood - 1.16-25Robbie Harwood - 1.16-24Robbie Harwood - 1.16-23Robbie Harwood - 1.16-22Robbie Harwood - 1.16-21Robbie Harwood - 1.16-20Robbie Harwood - 1.16-19Robbie Harwood - 1.16-18Robbie Harwood - 1.16-17Robbie Harwood - 1.16-16Robbie Harwood - 1.16-15Robbie Harwood - 1.16-14Robbie Harwood - 1.16-13Robbie Harwood - 1.16-12Robbie Harwood - 1.16-11Robbie Harwood - 1.16-10Robbie Harwood - 1.16-9Robbie Harwood - 1.16-8Robbie Harwood - 1.16-7Robbie Harwood - 1.16-6Fedora Release Engineering - 1.16-5Igor Gnatenko - 1.16-4Robbie Harwood - 1.16-3Robbie Harwood - 1.16-2Robbie Harwood - 1.16-1Robbie Harwood - 1.16-0.beta2.1Robbie Harwood - 1.16-0.beta1.4Robbie Harwood - 1.16-0.beta1.3Robbie Harwood - 1.16-0.beta1.2Robbie Harwood - 1.16-0.beta1.1Robbie Harwood - 1.15.2-2Robbie Harwood - 1.15.2-1Robbie Harwood - 1.15.1-28Robbie Harwood - 1.15.1-27Robbie Harwood - 1.15.1-26Robbie Harwood - 1.15.1-25Robbie Harwood - 1.15.1-24Robbie Harwood - 1.15.1-23Robbie Harwood - 1.15.1-22Robbie Harwood - 1.15.1-20Robbie Harwood - 1.15.1-19Fedora Release Engineering - 1.15.1-18Robbie Harwood - 1.15.1-17Robbie Harwood - 1.15.1-16Robbie Harwood - 1.15.1-15Robbie Harwood - 1.15.1-14Robbie Harwood - 1.15.1-13Robbie Harwood - 1.15.1-12Robbie Harwood - 1.15.1-11Robbie Harwood - 1.15.1-10Robbie Harwood - 1.15.1-9Robbie Harwood - 1.15.1-8Robbie Harwood - 1.15.1-7Robbie Harwood - 1.15.1-6Robbie Harwood - 1.15.1-5Robbie Harwood - 1.15.1-4Robbie Harwood - 1.15.1-3Robbie Harwood - 1.15.1-2Robbie Harwood - 1.15.1-1Robbie Harwood - 1.15-9Robbie Harwood - 1.15-8Robbie Harwood - 1.15-7Robbie Harwood - 1.15-6Robbie Harwood - 1.15-5Robbie Harwood - 1.15-4Robbie Harwood - 1.15-beta2-3Robbie Harwood - 1.15-beta1-2Robbie Harwood - 1.15-beta1-1Tomáš Mráz - 1.14.4-6Robbie Harwood - 1.14.4-5Robbie Harwood - 1.14.4-4Robbie HarwoxXLЭ4$$43 VS>QN2-t{02"x݉hm ^@//xއZt'Zw0 j!ٚkW`?xg${>9H mJiR#eFLf8q+ oL-黼HBؓqw%a3jdR& kCsCgY^дRMTj"MoF9T 8XL-B2Hp\X$D+@Է];md [u$;g׳HJp\2ܑI݊u677b1766be04ff05d0e43ae1ea1266b52f476df66e413aa18200f95a8cdaa38b355a201708cf1a4438ca5cbcc1ee6a167b4299e2j{xw!$j{xgmt.3.gz\pam_setcred.3.gz[pam_set_item.3.gzZpam_set_data.3.gzYpam_putenv.3.gzXpam_prompt.3.gzWpam_open_session.3.gzVpam_misc_setenv.3.gzUpam_misc_paste_env.3.gzTpam_misc_drop_env.3.gzS pam_info.3.gzRpam_getenvlist.3.gzQpam_getenv.3.gzPpam_get_user.3.gzOnpam_get_item.3.gzNspam_get_data.3.gzM-pam_get_authtok_verify.3.gzCL pam_get_authtok_noverify.3.gzK pam_get_authtok.3.gzJ-pam_fail_delay.3.gzpeIepam_error.3.gzan.H8 pam_end.3.gz$G pam_conv.3.gzF6pam_close_session.3.gz0cfEbpam_chauthtok.3.gzc3bD2pam_authenticate.3.gzCpam_acct_mgmt.3.gzcpB3pam.3.gzf0 pam-devel m pam_modutil.h o pam_modules.hl pam_misc.hehal pam_filter.hol pam_ext.hw pam_client.h( pam_appl.h pascal.jsOPp passwd.1.gzb-  jpam_xauth_data.3.gzi pam_vsyslog.3.gzh$pam_vprompt.3.gzg(pam_vinfo.3.gzf,pam_verror.3.gze0pam_syslog.3.gzd4pam_strerror.3.gzc8pam_start.3.gzb<pam_sm_setcred.3.gz?apam_sm_open_session.3.gzD`pam_sm_close_session.3.gz_pam_sm_chauthtok.3.gz^ppam_sm_authenticate.3.gzparking-box-fill.svgiparentheses-line.svgsiparentheses-fill.svgs70 parent.pm7u parent.3pm.gz}vparent-line.svgp|lparent-fill.svgg paragraph.svglpantone-line.svgapantone-fill.svg2vpanel.py]pam_sm_acct_mgmt.3.gz\pam_setcred.3.gz[pam_set_item.3.gzZpam_set_data.3.gzYpam_putenv.3.gzXpam_prompt.3.gzWpam_open_session.3.gz m pam_modutil.h o pam_modules.hVpam_misc_setenv.3.gzUpam_misc_paste_env.3.gzTpam_misc_drop_env.3.gzl pam_misc.hehaS pam_info.3.gzRpam_getenvlist.3.gzQpam_getenv.3.gzPpam_get_user.3.gzOnpam_get_item.3.gzNspam_get_data.3.gzM-pam_get_authtok_verify.3.gzCL pam_get_authtok_noverify.3.gzK pam_get_authtok.3.gzl pam_filter.hoJ-pam_fail_delay.3.gzpel pam_ext.hIepam_error.3.gzan.H8 pam_end.3.gz$G pam_conv.3.gzF6pam_close_session.3.gz0cfw pam_client.h(Ebpam_chauthtok.3.gzc3bD2pam_authenticate.3.gz pam_appl.hCpam_acct_mgmt.3.gzcpB3pam.3.gzf0 pam-devel2e palette.pyepalette-line.svgpalette-fill.svgpaint-line.svgpaint-fill.svgpaint-brush-line.svgpaint-brush-fill.svgapages-line.svgsvg`pages-fill.svg.sv2ppager.py-xXL Й$' in user record- Fix title on system-config-selinux- Updated version of policycoreutils * Build fix for setsebool.- Updated version of policycoreutils * Merged setsebool patch to only use libsemanage for persistent boolean changes from Stephen Smalley. * Merged genhomedircon patch to use the __default__ setting from Dan Walsh. * Dropped -b option from load_policy in preparation for always preserving booleans across reloads in the kernel.- Fixes for polgengui- Updated version of policycoreutils * Merged chcat, fixfiles, genhomedircon, restorecond, and restorecon patches from Dan Walsh.- Fix genhomedircon to handle non user_u for the default user- More cleanups for gui- Fix size and use_tmp problem on gui- Fix restorecon crash- Change polgengui to a druid- Fully path script.py- Add -l flag to restorecon to not traverse file systems- Fixes for policygengui- Add polgengui- Updated version of sepolgen * Merged seobject setransRecords patch to return the first alias from Xavier Toth.- Updated version of sepolgen * Merged updates to sepolgen-ifgen from Karl MacMillan. * Merged updates to sepolgen parser and tools from Karl MacMillan. This includes improved debugging support, handling of interface calls with list parameters, support for role transition rules, updated range transition rule support, and looser matching.- Don't generate invalid context with genhomedircon- Add filter to booleans page- Fix polgen.py to not generate udp rules on tcp input- system-config-selinux should be able to run on a disabled system, - at least enough to get it enabled.- Many fixes to polgengui- Updated version of sepolgen * Merged patch to discard self from types when generating requires from Karl MacMillan.- Change location of audit2allow and sepol-ifgen to sbin - Updated version of sepolgen * Merged patch to move the sepolgen runtime data from /usr/share to /var/lib to facilitate a read-only /usr from Karl MacMillan.- Add polgen gui - Many fixes to system-config-selinux- service restorecond status needs to set exit value correctly- Fix gui- Update to upstream * Merged restorecond init script LSB compliance patch from Steve Grubb. -sepolgen * Merged better matching for refpolicy style from Karl MacMillan * Merged support for extracting interface paramaters from interface calls from Karl MacMillan * Merged support for parsing USER_AVC audit messages from Karl MacMillan.- Update to upstream -sepolgen * Merged support for enabling parser debugging from Karl MacMillan. - Add sgrupp cleanup of restorcon init script- Add Bill Nottinham patch to run restorcond condrestart in postun- Update to upstream - policycoreutils * Merged newrole O_NONBLOCK fix from Linda Knippers. * Merged sepolgen and audit2allow patches to leave generated files in the current directory from Karl MacMillan. * Merged restorecond memory leak fix from Steve Grubb. -sepolgen * Merged patch to leave generated files (e.g. local.te) in current directory from Karl MacMillan. * Merged patch to make run-tests.py use unittest.main from Karl MacMillan. * Merged patch to update PLY from Karl MacMillan. * Merged patch to update the sepolgen parser to handle the latest reference policy from Karl MacMillan.- Do not fail on sepolgen-ifgen- Update to upstream * Merged translations update from Dan Walsh. * Merged chcat fixes from Dan Walsh. * Merged man page fixes from Dan Walsh. * Merged seobject prefix validity checking from Dan Walsh. * Merged Makefile and refparser.py patch from Dan Walsh. Fixes PYTHONLIBDIR definition and error handling on interface files.- Updated newrole NONBlOCK patch- Remove Requires: %{name}-plugins- Update to upstream * Merged seobject exception handler fix from Caleb Case. * Merged setfiles memory leak patch from Todd MillexzXLp8K$KKKdirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8deef524601ca21fbeddf6417e36f6b402cdd8f9, strippedPython script, ASCII text executableASCII texta /usr/bin/python3.12 script, ASCII text executableRRRRRRR utf-895cee234aac11b98d630432539cb3b2742208e379ac72ad3d69b5cc9ca558342?@9܉3!^P,*%j *%wgq]WH!<1"I7}%˟Z#2cTcç \5!@@ *fqv!*y^1rMDh_E (2Y6ڷKpbqL9(}X-tS*o+810k@a}TW;*:tJb2oԩU}馉҄ǿO]nPXSHy=3A`6?/1%W\s~9::N!',jůfZx 5 ׵7}i$c\>pՈŦfBΫ`#4e+P:AJ~FdfmXPPv)}_vN/A0Q2(N0Xm 2MYd4d*!.B_v5*/^O>3;᠔Ha"1 @䖒8_]ӳxUK7mY0+9-rP nyE1y`m]jY'ӄMxn'-XΒF7;At&@+ӊHetqź5(嵶`4nJOBOA: iabYmfK BM)^Mhsյ.(]"H%6~hC6}\,D<c GFjMO%8o!td Dgד! Ђ40;RIr=&.4^ ):edF]ެD!яR#˜ER>zf6j5KF 0}׷\WAuG͐(N0U |?>niu҃P(k{6{1e476e3c4a19c04909189990f022e90b4c452e6a1e90a7f6e55ad9e1cb57a41d8e022f0d489619d2b0b5afff8642434de1c21e211jqxpiXL] k-${k-j-l-section and removed execute bits.- Updated to 1.5.0.0 - removed version cut/mversion, since source untars properly now.- Updated to 1.4.3.1- Removed DESTDIR export and fixed two capitals- Initial version based on Pascal Bleser suse rpm  !"#$1.7.4.1-2.el8_101.7.4.1-2.el8_10filanprocansocat.build-id68a180c3c400f4456d3886b7f8b3a702379a7a14f3ea5700f8a77a0681e5aa1c64b5c9fbcca6e88afc4728ca609963f9f57c800c54f3577b51ae5eaesocatBUGREPORTSCHANGESCOPYINGCOPYING.OpenSSLDEVELOPMENTEXAMPLESFAQPORTINGREADMESECURITYdaemon.shftp.shgatherinfo.shmail.shproxy.shproxyecho.shreadline-test.shreadline.shsocat_buildscript_for_android.shsocks4a-echo.shsocks4echo.shtest.shfilan.1.gzprocan.1.gzsocat.1.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/68//usr/lib/.build-id/f3//usr/lib/.build-id/fc//usr/share/doc//usr/share/doc/socat//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu  ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=68a180c3c400f4456d3886b7f8b3a702379a7a14, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f3ea5700f8a77a0681e5aa1c64b5c9fbcca6e88a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fc4728ca609963f9f57c800c54f3577b51ae5eae, strippeddirectoryASCII textUTF-8 Unicode textC source, ASCII text, with very long linesHTML document, ASCII textC source, ASCII textPOSIX shell script, ASCII text executableBourne-Again shell script, ASCII text executableBourne-Again shell script, ASCII text executable, with very long linestroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)RRRRRRRRR RR R RRRRRRRRRRRR RR R RRRRR R RRRRRRRR RR R RRRutf-887a6d593a49112917831c2905a1f5bf1c877b5ac84745003c91c029ae536be4b?@43!^P,*%hv?P *%[Z>k ިR3@tz}#$bHֱFV Jp岴Q{sxXXMLwH$mHHG1@?-4d   C J`.d. . . .  .  ..~.d.@`   (89$:Gx.H 0.I .X!Y! \!D.]!.^$!b%rd&e&f&l&t&.u'.v(T w+$.x+.y,,,,-0-D-H. . 0011.14g18h1<Clua-socket3.00.17.rc1.el8Network support for the Lua languageLuaSocket is a Lua extension library that is composed by two parts: a C core that provides support for the TCP and UDP transport layers, and a set of Lua modules that add support for functionality commonly needed by applications that deal with the Internet. Among the support modules, the most commonly used implement the SMTP, HTTP and FTP. In addition there are modules for MIME, URL handling and LTN12.]mbuild.cloudlinux.com ACloudLinuxCloudLinuxMITCloudLinux Packaging Team Development/Librarieshttp://www.tecgraf.puc-rio.br/~diego/professional/luasocket/linuxx86_64,,.*?` f%],+0*-7P86*SB 9 c$r03+AAAAAAAA큤A큤A큤]m]m]m]m]m]m]m]m]m]m]m]m]m]m]m]mQ$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$Q$]m]m]m]m]m]m]m]m]m]m]m]m826f08ca03041bce76a5f714b2e04d040a9bac5935098287a5c9e7613e401d767eb7e98bbe373c94d42075e9ebed89476d6d46a61feef3f086b757c4e8d7d955d65ee6c8f71454e1b06f7621a62c7094fd2ae35debd7582f4924556e3143dd644e6c12a5a3682f3575691d22a4daf62ba344a4d3075d2f14a94799357cf1eed8c2d17c3e884bbf307626e78c5f046c4541db9824fe7b026b3f135f7fae25c4aa6f1d4dfb356d3c1bbcd4cf1788cde4e3f09a4d3fe16bd34f23a8816b73c36e31a8572944efb1cd91c0c2bf16f21e641cc4412f6c1616647bb720bd07e2823573d01d055a86107470e93dbd111f94a8d95860afe7df7fb77c9dd108efa4618761711934cebb80371869375b030629963435786af57b67297f03d9a159643b1aa2ec29bb4a22ea7bf1af6ba496b3ca0cba45c4fc0bad3cf43b143f2de79144ac66b900cd1fe039e4cfea020ff20692ec03af933b4a05bc50450b06c021390dbdf3cbe1d8343691a4f8492753a4ac9b6b47953a10460d6890c0a64aa6621f36c44740f215e19aae66edf7b8968fc2993a71668bf5b25b868b8bbfadf17c2e436ae643f1a7e7247dc9e2b603343c57ef035011e5f26c3e2f51463e4100df70e344f26abd206284e5e822a4badccec45d091f67e79fbc51e19dfd9f625e2a1b9940d65eb02ce03ad22af18105b57cdd5d1cb3b2929029aee3190bd110a4db92787f008bb62edfe7e756078a38adececcf745153a74425355585ef5fee79eb6f2e280b8088c9f331b7bbed36b583e80ff1f5f09ec0cb68d5faaf3d67269adb79dcf129c1db42381acf960bb46d101945eeb047f38ee10b905b55580f635b808db77a5d09e5eb2e0ba4d79068e88bd22803cf820021c5e1d01f9f92b8a8ef62139de4a94ca93c1d1ec25d1cdf5f72db0cb22e9f0100ff190bfa6cc99690116e3798a57cd7641b5525b8c71a913784cc5a42437ad10d1478f48a941e7edcfd422934739ecc917b9324c01a3b9357e010a213e86d2a31a8a96cefcd2fe11168c3d5814e083bf0000f86d25da94089d47de3bbb204fd5be491edbe275730e73f68c710ea42a548fc214ac1e935afa683df9bdbeded0ca60cf353dfcc16f6db0187b9fc512d332871e3beeaccf8bff18cde1509e81c2bd16beb511b1fe586cx@HXL0  $ / 7Joe Orton - 2.4.6-16Joe Orton - 2.4.6-15Daniel Mach - 2.4.6-14Joe Orton - 2.4.6-13Joe Orton - 2.4.6-12Joe Orton - 2.4.6-11Joe Orton - 2.4.6-10Daniel Mach - 2.4.6-9Joe Orton - 2.4.6-8Jan Kaluza - 2.4.6-7Jan Kaluza - 2.4.6-6Jan Kaluza - 2.4.6-5Jan Kaluza - 2.4.6-4Jan Kaluza - 2.4.6-3Jan Kaluza - 2.4.6-2Joe Orton - 2.4.6-1Jan Kaluza - 2.4.4-12Joe Orton - 2.4.4-11Joe Orton - 2.4.4-10Joe Orton - 2.4.4-9Jan Kaluza - 2.4.4-8Jan Kaluza - 2.4.4-6Jan Kaluza - 2.4.4-5Jan Kaluza - 2.4.4-4Jan Kaluza - 2.4.4-3Joe Orton - 2.4.4-2Joe Orton - 2.4.4-1Joe Orton - 2.4.3-17Fedora Release Engineering - 2.4.3-16Joe Orton - 2.4.3-15Joe Orton - 2.4.3-14Joe Orton - 2.4.3-13Joe Orton - 2.4.3-12Joe Orton - 2.4.3-11Joe Orton - 2.4.3-10Joe Orton - 2.4.3-9.1Joe Orton - 2.4.3-9Joe Orton - 2.4.3-8Joe Orton - 2.4.3-7Jan Kaluza - 2.4.3-6Joe Orton - 2.4.3-5Joe Orton - 2.4.3-4Jan Kaluza - 2.4.3-3Joe Orton - 2.4.3-2Joe Orton - 2.4.3-1Joe Orton - 2.4.2-23Fedora Release Engineering - 2.4.2-22Joe Orton - 2.4.2-21Joe Orton - 2.4.2-20Joe Orton - 2.4.2-19Joe Orton - 2.4.2-18Joe Orton - 2.4.2-17Joe Orton - 2.4.2-16Joe Orton - 2.4.2-15Joe Orton - 2.4.2-14Joe Orton - 2.4.2-13Joe Orton - 2.4.2-12Joe Orton - 2.4.2-11Joe Orton - 2.4.2-10Joe Orton - 2.4.2-9Joe Orton - 2.4.2-8Joe Orton - 2.4.2-7Joe Orton - 2.4.2-6Joe Orton - 2.4.2-5Joe Orton - 2.4.2-4Joe Orton - 2.4.2-3.2Joe Orton - 2.4.2-3Joe Orton - 2.4.2-2Jan Kaluza - 2.4.2-1Joe Orton - 2.4.1-6Joe Orton - 2.4.1-5Joe Orton - 2.4.1-4Joe Orton - 2.4.1-3Joe Orton - 2.4.1-2Joe Orton - 2.4.1-1Joe Orton - 2.2.22-2Joe Orton - 2.2.22-1Petr Pisar - 2.2.21-8Jan Kaluza - 2.2.21-7Joe Orton - 2.2.21-6Fedora Release Engineering - 2.2.21-5Jan Kaluza - 2.2.21-4Jan Kaluza - 2.2.21-3Ville Skyttä - 2.2.21-2Joe Orton - 2.2.21-1Joe Orton - 2.2.20-1Jan Kaluza - 2.2.19-5Iain Arnell 1:2.2.19-4Jan Kaluza - 2.2.19-3Jan Kaluza - 2.2.19-2Joe Orton - 2.2.19-1Joe Orton - 2.2.17-13Joe Orton - 2.2.17-12Joe Orton - 2.2.17-11Joe Orton - 2.2.17-10Joe Orton - 2.2.17-9Fedora Release Enginex7XL$dwalsh@redhat.com> - 2.1.14-37Dan Walsh - 2.1.14-36Dan Walsh - 2.1.14-35Dan Walsh - 2.1.14-34Dan Walsh - 2.1.14-33Dan Walsh - 2.1.14-32Dan Walsh - 2.1.14-31Dan Walsh - 2.1.14-30Dan Walsh - 2.1.14-28Dan Walsh - 2.1.14-27Dan Walsh - 2.1.14-26Dan Walsh - 2.1.14-25Dan Walsh - 2.1.14-24Dan Walsh - 2.1.14-23Dan Walsh - 2.1.14-22Dan Walsh - 2.1.14-21Dan Walsh - 2.1.14-20Dan Walsh - 2.1.14-19Dan Walsh - 2.1.14-18Dan Walsh - 2.1.14-17Dan Walsh - 2.1.14-16Dan Walsh - 2.1.14-15Dan Walsh - 2.1.14-14Dan Walsh - 2.1.14-13Rahul Sundaram - 2.1.14-13Dan Walsh - 2.1.14-12Dan Walsh - 2.1.14-11Dan Walsh - 2.1.14-10Dan Walsh - 2.1.14-9Dan Walsh - 2.1.14-8Dan Walsh - 2.1.14-7Dan Walsh - 2.1.14-6Dan Walsh - 2.1.14-5Dan Walsh - 2.1.14-4Dan Walsh - 2.1.14-3Dan Walsh - 2.1.14-2Dan Walsh - 2.1.14-1Dan Walsh - 2.1.12-58Dan Walsh - 2.1.12-57Dan Walsh - 2.1.12-56Dan Walsh - 2.1.12-55Dan Walsh - 2.1.12-54Dan Walsh - 2.1.12-53Dan Walsh - 2.1.12-52Dan Walsh - 2.1.12-51Dan Walsh - 2.1.12-50Dan Walsh - 2.1.12-49Dan Walsh - 2.1.12-48Dan Walsh - 2.1.12-47Dan Walsh - 2.1.12-46Dan Walsh - 2.1.12-45Dan Walsh - 2.1.12-44Dan Walsh - 2.1.12-43Dan Walsh - 2.1.12-42Dan Walsh - 2.1.12-41Dan Walsh - 2.1.12-40Dan Walsh - 2.1.12-39Dan Walsh - 2.1.12-38Dan Walsh - 2.1.12-37Dan Walsh - 2.1.12-36Dan Walsh - 2.1.12-35Dan Walsh - 2.1.12-34Dan Walsh - 2.1.12-33Dan Walsh - 2.1.12-32Dan Walsh - 2.1.12-31Dan Walsh - 2.1.12-30Dan Walsh - 2.1.12-29Dan Walsh - 2.1.12-27Dan Walsh - 2.1.12-26Dan Walsh - 2.1.12-25Dan Walsh - 2.1.12-24Dan Walsh - 2.1.12-23Dan Walsh - 2.1.12-22Dan Walsh - 2.1.12-21Dan Walsh - 2.1.12-20Dan Walsh - 2.1.12-19Dan Walsh - 2.1.12-18Dan Walsh - 2.1.12-17Dan Walsh - 2.1.12-16Dan Walsh - 2.1.12-15Dan Walsh - 2.1.12-14Dan Walsh - 2.1.12-13Dan Walsh - 2.1.12-12Dan Walsh - 2.1.12-11Dan Walsh - 2.1.12-10Dan Walsh - 2.1.12-9Dan Walsh - 2.1.12-8Dan Walsh - 2.1.12-7Dan Walsh - 2.1.12-6Dan Walsh - 2.1.12-5Dan Walsh - 2.1.12-4Dan Walsh - 2.1.12-3Dan Walsh - 2.1.12-2Dan Walsh - 2.1.12-1Dan Walsh - 2.1.11-6Dan Walsh - 2.1.11-5Dan Walsh - 2.1.11-4Dan Walsh Development/Librarieshttp://en.wikipedia.org/wiki/Util-linuxlinuxx86_64RR@Rg@REs@R-@R-@QMQ@Q@Q(@Q@QyQkQkQg@QeT@QR@QR@QLGQ$Q#i@QEQQ@PDP@P@P*Pd@Pd@Puc@Pl(PH@P,PO؀Ot@Ou@OG{O3@O1@OOn@NˎN@N @N[@NK@N7N@MMMtMS@MQ0@MOM>@M>@M6@M$]@LLk@LZLV@L+1L_L0K @K@KqKzKzKuBKG@KG@K&(K@K@K y@JUJTJJ@JęJ@J0@J#J/@J@Jyt@Jq@JmJjJ/@J,@J'@IԨIÅ@IÅ@I3I2I@IIIx_IO@I&HHǶHǶH@HnHj@HM@H1kH @H;HGu@G:GGG{|G_@G_@G[G(n@GGF@F@F%@Fɂ@Fɂ@Fɂ@Fɂ@FFGF6@Ec@E&E1@E@EC@BӰBiBx@Bv@Bv@BlBR}BK@BC@B8B@Aʳ@AA@A@A@Anj@AmAmAmAjuAc@AZAYR@AH.AH.A4h@A-A @A @A @A!@@@@@c@@@@@@`&@\2@@V@@V@@R@R@PT@O@@O@@K@?1@@9@@5@,@@+j@@@@@@@?C@?@?@?Y@?r?j?a@?a@?Xz?Xz?W)@?7@?&a?x>@>@>@>@>@>\>h@>9@>D>pr>Z @>Sq>K>>Y>>Y>=@>7@>.>"@>"@==x@==1@==0@=o^@=Q =Jt@=>==E@=;=!=O=@=@=@=@==@< - 2.27.1-4Karel Zak - 2.27.1-3Fedora Release Engineering - 2.27.1-2Karel Zak - 2.27.1Karel Zak - 2.27Karel Zak - 2.27-0.4Karel Zak - 2.27-0.3Karel Zak - 2.27-0.2Karel Zak - 2.27-0.1Karel Zak - 2.26.2-3Fedora Release Engineering - 2.26.2-2Karel Zak - 2.26.2-1Till Maas - 2.26-2Karel Zak 2.26-1Karel Zak 2.26-0.4Karel Zak 2.26-0.3Karel Zak 2.26-0.2Karel Zak 2.26-0.1Karel Zak 2.25.2-2Karel Zak 2.25.2-1Karel Zak 2.25.1-1Karel Zak 2.25.1-0.1Fedora Release Engineering - 2.25-4Tom Callaway 2.25-3Karel Zak 2.25-2Karel Zak 2.25-1Karel Zak 2.25-0.3Peter Jones - 2.25-0.2Karel Zak 2.25-0.1Fedora Release Engineering - 2.24.2-6Kalev Lember - 2.24.2-5Karel Zak 2.24.2-4Karel Zak 2.24.2-3Karel Zak 2.24.2-2Karel Zak 2.24.2-1Karel Zak 2.24.1-2Karel Zak 2.24.1-1Karel Zak 2.24-2Karel Zak 2.24-1Karel Zak 2.24-0.1Karel Zak 2.23.2-4Karel Zak 2.23.2-3Karel Zak 2.23.2-2Karel Zak 2.23.2-1Karel Zak 2.23.1-3Karel Zak 2.23.1-2Karel Zak 2.23.1-1Karel Zak 2.23-1Karel Zak 2.23-0.7Karel Zak 2.23-0.6Karel Zak 2.23-0.5Karel Zak 2.23-0.4Karel Zak 2.23-0.3Karel Zak 2.23-0.2Karel Zak 2.23-0.1Karel Zak 2.22.2-6Karel Zak 2.22.2-5Karel Zak 2.22.2-4Karel Zak 2.22.2-3Karel Zak 2.22.2-2Karel Zak 2.22.2-1Karel Zak 2.22.1-5Karel Zak 2.22.1-4Karel Zak 2.22.1-3Karel Zak 2.22.1-2Karel Zak 2.22.1-1Karel Zak 2.22-2Karel Zak 2.22-1Karel Zak 2.22-0.1Fedora Release Engineering - 2.21.2-3Karel Zak 2.21.2-2Karel Zak 2.21.2-1Karel Zak 2.21.1-1Karel Zak 2.21-1Karel Zak 2.21-0.2Karel Zak 2.21-0.1Harald Hoyer 2.20.1-5Fedora Release Engineering - 2.20.1-4Karel Zak 2.20.1-3Fedora Release Engineering - 2.20.1-2Karel Zak 2.20.1-1Karel Zak 2.20-1Karel Zak 2.20-0.2Karel Zak 2.20-0.1Karel Zak 2.19.1-2Karel Zak 2.19.1-1Karel Zak 2.19.1-0.1Karel Zak 2.19-2Karel Zak 2.19-1Karel Zak 2.19-0.6Fedora Release Engineering - 2.19-0.5Karel Zak 2.19-0.4Karel Zak 2.19-0.3Karel Zak 2.19-0.2Karel Zak 2.19-0.1Karel Zak 2.18-5Karel Zak 2.18-4Karel Zak 2.18-3Karel Zak 2.18-2Karel Zak 2.18-1Karel Zak 2.18-0.2Karel Zak 2xXL 1aO$qaObO`Of7e23a9c65890ea612358c8469f18cc3c84ff5402c24a3b0dca63f0f6579e6c324e0c59887fb5312c7314ac70924b6bb80b74d3a835bfd4d02c30ec55166983847553a5b2e2d75457bb67b3296ca8345f607e5b0d3d2735b6bdcb5a27552819e195ed9d2f8c96aa7904d1e005d862e01755f1b4f4be3c3863db57cf7c162e49daf2b0c729706cee0026d13c4acb5da27c41e315b6f8d327d53acf27ae3d0ae58bb505b0e5b2d2c53e4a1f4e3a471fd74d50e8597d59969d2995db701821d78bdc23e0f8c56278a303e1f0123d79ae92466dede7ac7c5e9d5762e58brootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php84-net-dns2-1.5.0-1.cp130~el8.src.rpmcpanel-php84-net-dns2     /bin/sh/bin/shcpanel-php84cpanel-php84cpanel-php84rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3hAg$_~@ZXO@W@U+R@QbQa_P,PYP.2@P(@Om@N`N-ZN M)M4@ML@Lq@L5Sloane Bernstein - 1.5.0-1.cp130~el8Andy Baugh - 1.5.0-2.cp118Todd Rinaldo - 1.5.0-1.cp118Todd Rinaldo - 1.4.4-1.cp118Todd Rinaldo - 1.4.3-1.cp118Todd Rinaldo - 1.4.2-1.cp118Todd Rinaldo - 1.4.1-1.cp118Todd Rinaldo - 1.3.2-1.cp118Todd Rinaldo - 1.3.1-1.cp118Todd Rinaldo - 1.3.0-1.cp118Todd Rinaldo - 1.2.5-1.cp118Todd Rinaldo - 1.2.4-1.cp118Todd Rinaldo - 1.2.3-1.cp118Todd Rinaldo - 1.2.2-1.cp118Todd Rinaldo - 1.2.1-1.cp118Todd Rinaldo - 1.2.0-1.cp118Todd Rinaldo - 1.1.4-1.cp118Todd Rinaldo - 1.1.3-1.cp118Todd Rinaldo - 1.1.2-1.cp118Todd Rinaldo - 1.1.1-1.cp118Todd Rinaldo - 1.1.0-1.cp118Todd Rinaldo - 1.0.1-1.cp118Todd Rinaldo - 1.0.0-1.cp118Todd Rinaldo - 0.6.0-1.cp118- Build for cPanel 130- Fix changelog generation- added the AMTRELAY resource recordxX0L $  ext (gzip compressed data, max compression, from Unix)C source, ASCII text (gzip compressed data, max compression, from Unix))*+,- RRRR RRR R RRR R RRRRR RRR R RRR R RRRRR RRR R RRR R RRRRRRRRhttps://bugz.fedoraproject.org/rcsutf-80515ceb0b6b1faa86c846cb2800b7e087594b9ff9373789700b3349c86c8790d?00'aDN#J f932ҟ:krVy ؀Z*Ÿ|=Bv6650db7021bc4be664b8b0bb1cb54247c28930ef7732681a5b0c59710f2eda6106f57c47a0ec0ba36759b68cdd8fe8198cde938bj{y j{xild to pick up new build flags from redhat-rpm-config- Escape macros in %changelog- Fix parsing braced subscript after parentheses (RT#8045) - Fix a heap use after free when moving a stack (RT#131954) - Call ldconfig scriptlets using a macro- Correct shell bangs in tests- Link XS modules to pthread library to fix linking with -z defs- Add patch to conditionalize a fix for an old and long fixed bug in libcrypt / glibc (rhbz#1536752)- Rebuild against glibc without nsl library- Remove invalid macro definitions from macros.perl (bug #1532539) - Fix an overflow in the lexer when reading a new line (RT#131793) - Fix Term::ReadLine not to create spurious &STDERR files (RT#132008) - Fix a crash when a match for inversely repeated group fails (RT#132017) - Fix an overflow when parsing a character range with no preceding character (RT#132245) - Fix walking symbol table for ISA in Carp - Fix handling file names with null bytes in stat and lstat functions (RT#131895) - Fix a crash when untying an object witout a stash - Fix deparsing of transliterations with unprintable characters (RT#132405) - Fix error reporting on do() on a directory (RT#125774) - Fix stack manipulation when a lexical subroutine is defined in a do block in a member of an iteration list (RT#132442) - Fix setting $! when statting a closed file handle (RT#108288) - Fix tainting of s/// with overloaded replacement (RT#115266) - Expand system() arguments before a fork (RT#121105) - Avoid undefined behavior when copying memory in Glob and pp_caller (RT#131746)- Update perl(:MODULE_COMPAT)- 5.26.1 bump (see for release notes)- Fix unreliable Time-HiRes tests (CPAN RT#122819) - Do not require $Config{libs} providers by perl-devel package (bug #1481324)- Fix reporting malformed UTF-8 character (RT#131646) - Fix File::Glob rt131211.t test random failures - Fix t/op/hash.t test random failures - Parse caret variables with subscripts as normal variables inside ${...} escaping (RT#131664) - Do not display too many bytes when reporting malformed UTF-8 character - Fix select called with a repeated magical variable (RT#131645) - Fix error message for "our sub foo::bar" (RT#131679) - Fix executing arybase::_tie_it() in Safe compartement (RT#131588) - Fix handling attribute specification on our variables (RT#131597) - Fix splitting non-ASCII strings if unicode_strings feature is enabled (RT#130907) - Fix compiler warnings in code generated by ExtUtils::Constant (CPAN RT#63832, CPAN RT#101487) - Fix GCC version detection for -D_FORTIFY_SOURCxpX# LgD$wgDfDhDJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoafazbgcacrhcsdadeeleneoesfifrfurglhrhuiditjakakokyltnbnlplptptrorurwskslsqsrsvtrukvizhzh2.28-1.el8            !"#$%&'()*+,-./0123456789:;<=>?@ABCDExkbcompatREADMEaccessxbasiccapscompleteiso9995japanledcapslednumledscrolllevel5miscmousekeysolpcpcpc98xfree86xtestgeometryREADMEamigaatarittchiconydelldigital_vndrlkpcunixeverexfujitsuhhkhpkeytronickinesismacintoshmicrosoftnecnokianorthgatepcsanwasgi_vndrO2indigoindysonysteelseriessunteckthinkpadtypematrixwinbookkeycodesREADMEaliasesamigaatarittdigital_vndrlkpcemptyevdevfujitsuhpibmjollamacintosholpcsgi_vndrindigoindyirissonysunxfree86xfree98rulesREADMEbasebase.extras.xmlbase.lstbase.xmlevdevevdev.extras.xmlevdev.lstevdev.xmlxfree98xkb.dtdxkb.itsxorgxorg.lstxorg.xmlsymbolsafalaltwinamaplaraatauazbabdbebgbrbraibtbwbycacapslockcdchcmcncomposectrlczdedigital_vndrlkpcusvtdkdzeeemptyepoeseteueurosignfifofrfujitsu_vndrjpusgbgeghgngrgrouphp_vndrushrhuidieilininetiqirisitjolla_vndrsbjjpkekeypadkgkhkpdlkrkzlalatamlatinlevel3level5lkltlvmamacintosh_vndrapplechdedkfifrgbisitjplatamnlnoptseusmaomdmemkmlmmmnmtmvmynbspnec_vndrjpngnlnonokia_vndrrx-44rx-51su-8wnpolpcparenspcphpkplptrorsrurupeesignsesgi_vndrjpsharp_vndrsl-c3x00ws003shws007shws011shws020shshiftsisksnsony_vndrussrvr_ctrlsun_vndrarabebrcachczdedkeeesfifrgbgritjpkrltlvnlnoplptrorusesksolaristrtwuaussyterminatetgthtjtmtrtranstwtypotzuausuzvnxfree68_vndramigaatarittzatypesREADMEbasiccancelcapscompletedefaultextraiso9995level5mousekeysnokianumpadpcxkeyboard-configAUTHORSCOPYINGHOWTO.testingHOWTO.transitionNEWSREADMEREADME.configREADME.enhancingREADME.symbolsTODOxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboardx] pX# Lh0aA$qaA`AbA and translations together - Adds new Modulemd.index_from_*() funtions to get a hash table of Modulemd.ImprovedModule objects for easier searching - Moves function documentation to the public headers - Corrects the license headers to MIT (they were incorrectly listed as MITNFA in previous releases) - Makes the "eol" field optional for Modulemd.ServiceLevel - Clean up HTML documentation - Fixes a type error on 32-bit systems- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Update to libdmodulemd 1.5.2 - Don't free uninitialized memory- Fix buildopts property not being initialized- Update to version 1.5.1 - Re-enable build-time tests- Temporarily disable build-time tests- Update to version 1.5.0 - Adds support for "intents" in Modulemd.Defaults - Adds `Modulemd.get_version()` - Adds support for RPM whitelists in the buildopts - Adds a new object: Modulemd.Buildopts - Deprecates Modulemd.Module.get_rpm_buildopts() - Deprecates Modulemd.Module.set_rpm_buildopts() - Fixes some missing license blurbs- Update to version 1.4.1 - Improve output from modulemd-validator - Drop upstreamed patches- Fix pointer math error - Fix compilation failure in Fedora build system- Update to version 1.4.0 - Adds new API for returning failed YAML subdocuments - Stop emitting log messages by default (polluting consumer logs) - Validate RPM artifacts for proper NEVRA format - Improve the validator tool - Drop upstreamed patch- Fix serious error in modulemd-defaults emitter- Update to version 1.3.0 - New Public Objects: * Modulemd.Prioritizer - tool to merge module defaults - New Public Functions: * Modulemd.SimpleSet.is_equal() * Modulemd.Defaults.copy() * Modulemd.Defaults.merge()- Update to version 1.2.0 - New Functions: * Modulemd.objects_from_file() * Modulemd.objects_from_string() * Modulemd.dump() * Modulemd.dumps() * Modulemd.Defaults.new_from_file() * Modulemd.Defaults.new_from_string() - Deprecated Functions: * Modulemd.Module.new_all_from_file() * Modulemd.Module.new_all_from_file_ext() * Modulemd.Module.new_all_from_string() * Modulemd.Module.new_all_from_string_ext() * Modulemd.Module.dump_all() * Modulemd.Module.dumps_all() - Bugfixes * Properly use G_BEGIN_DECLS and G_END_DECLS in headers * Assorted fixes for memory ownership in GObject Introspection- Fix missing G_END_DECL from public headers- Fix numerous memory leaks - Drop upstreamed patch- Update to version 1.1.2 - Revert backwards-incompatible API change - Fix version string in pkgconfig file- Update to version 1.1.1 - Make default stream and profiles optional - Fixes: https://github.com/fedora-modularity/libmodulemd/issues/25 - Fixes: https://github.com/fedora-modularity/libmodulemd/issues/26 - Fixes: https://github.com/fedora-modularity/libmodulemd/issues/27- Update to version 1.1.0 - Adds support for handling modulemd-defaults YAML documents - Adds peek()/dup() routines to all object properties - Adds Modulemd.Module.dup_nsvc() to retrieve the canonical form of the unique module identifier. - Adds support for boolean types in the XMD section - Revert obsoletion of pythonX-modulemd packages for now- Obsolete unsupported pythonX-modulemd packages- Update to 1.0.4 - Rework version autodetection - Avoid infinite loop on unparseable YAML- RPM components are properly emitted when no module components exist - Parser works around late determination of modulemd version- Be more strict with certain parser edge-cases - Replace popt argument processing with glib - Drop upstreamed patches- Handle certain unlikely format violations- Support modulemd v2 - Add tool to do quick validation of modulemd - Fix memory management - Warn and ignore unparseable sub-documents in the YAML - Fix several memory issues detected by Coverity scan- Update to libmodulemd 0.2.2 - Fix numerous minor memory leaks - Fix issues with EOL/SL dates- Own appropriate directories- Switch to %ldconfig_scriptlets- Update to libmodulemd 0.2.1 - Add 'name' property for Profiles- Add missing BuildRequires for gtxصX LH$Qgzsandbox.8.gzsemanage-boolean.8.gzsemanage-dontaudit.8.gzsemanage-export.8.gzsemanage-fcontext.8.gzsemanage-ibendport.8.gzsemanage-ibpkey.8.gzsemanage-import.8.gzsemanage-interface.8.gzsemanage-login.8.gzsemanage-module.8.gzsemanage-node.8.gzsemanage-permissive.8.gzsemanage-port.8.gzsemanage-user.8.gzsemanage.8.gz/etc/dbus-1/system.d//usr/bin//usr/sbin//usr/share/bash-completion/completions//usr/share/man/man1//usr/share/man/man8//usr/share/man/ru/man1//usr/share/man/ru/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2s390x-redhat-linux-gnu XML 1.0 document, ASCII textPython script, ASCII text executablePython script, ASCII text executable, with very long linesASCII textC++ source, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)C++ source, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)RRRRutf-8cf2df63e19fb0afd5f946d3ce8722658aa17588b94ea47bd541c55a51a422d8d?(3!^P,*%fV *%N#X,.)9 gB߇*ws V*N<ܳd_L.8gy,/X gSI /"7+0N;+pͨO`!$GYH\ "%/;΃ S7I)h}ZNT7kZvgcc2FZ(D(ZG`Xuyf 庾I +v C-tK[/r(M؂\aX<웭E9] Nr! 'F o}2BmE[=!9ə%۩̜QqjZ>>=(ڂ3yu,-e nP'y'~ѷi>@0~h|:7K%'eu)'V>8qSX a'Da[jDۇø4N ,B%7ksp[*}_@JuЬʲʄ: kr,S{`SS6ǖPpfb#S yd|,ז 47;Œ5)?VEJ܆p $})[~^K.:- )<[<$z|ȩolU:p}-i/aP"ŵJ$XûqojV욌~#2z0757ff58565faf210b40a0622e0ef8c9b08c9e72ca0250e1a3162f647fe11d89fae76bf2881a5175606a680f609d57b5bf73192ej{y@Cj{xea-apr/est/usr/share/doc/ea-apr-util/  o!/usr/share/doc/ea-apache24-tools/Q//usr/share/doc/e2fsprogs/7 t/usr/share/doc/dhcp-client/r/ /usr/share/doc/cyrus-sasl/l-Dl;/usr/share/doc/cpanel-php81-xml-serializer-0.21.0/examples/xسXL$5 - Print usage for all mutually exclusive options. - Fix selinux man page to refer seinfo and sesearch tools.- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Changes/Python_3.4- Fix setfiles to work correctly if -r option is defined- Update Miroslav Grepl Patches * If there is no executable we don't want to print a part of STANDARD FILE CON * Add-manpages-for-typealiased-types * Make fixfiles_exclude_dirs working if there is a substituion for the given d- If there is no executable we don't want to print a part of STANDARD FILE CONTEXT- Update to upstream * Add -P semodule option to man page from Dan Walsh. * selinux_current_policy_path will return none on a disabled SELinux system from Dan Walsh. * Add new icons for sepolicy gui from Dan Walsh. * Only return writeable files that are enabled from Dan Walsh. * Add domain to short list of domains, when -t and -d from Dan Walsh. * Fix up desktop files to match current standards from Dan Walsh. * Add support to return sensitivities and categories for python from Dan Walsh. * Cleanup whitespace from Dan Walsh. * Add message to tell user to install sandbox policy from Dan Walsh. * Add systemd unit file for mcstrans from Laurent Bigonville. * Improve restorecond systemd unit file from Laurent Bigonville. * Minor man pages improvements from Laurent Bigonville.- Apply patch to use setcon in seunshare from luto@mit.edu- Remove requirement for systemd-units- Fix previous Fix-STANDARD_FILE_CONTEXT patch to exclude if non_exec does not exist- Add policycoreutils-rhat-revert.patch to revert the last two commits to make build working - Add 0001-Fix-STANDARD_FILE_CONTEXT-section-in-man-pages patch- Update Translations- Add support for Fedora21 html manpage structure - Fix broken dependencies to require only usermode-gtk- mgrepl [PATCH] Deleteall user customization fails if there is a user used - for the default login. We do not want to fail on it and continue to delete - customizations for users which are not used for default login.- Update Translations - Make selinux-policy build working also on another architectures related to s - Miroslav grepl patch to fix the creation of man pages on different architectures. - Add ability to list the actual active modules - Fix spelling mistake on sesearch in generate man pages.- Allow manpages to be built on aarch64- Don't be verbose in fixfiles if there is not tty- Yum should only be required for policycoreutils-devel- Update translations- Add Miroslav patch to - Fix previously_modified_initialize() to show modified changes properly for all selections- Do not require /usr/share/selinux/devel/Makefile to build permissive domains- Update to upstream * Ignore selevel/serange if MLS is disabled from Sven Vermeulen.- Update Tranlations - Patch from Yuri Chornoivan to fix typos- Fixes Customized booleans causing a crash of the sepolicy gui- Fix sepolicy gui selection for advanced screen - Update Translations - Move requires checkpolicy requirement into policycoreutils-python- Fix semanage man page description of import command - Fix policy kit file to allow changing to permissive mode- Fix broken dependencies.- Break out python3 code into separate package- Add mgrepl patch - ptrace should be a part of deny_ptrace boolean in TEMPLATETYPE_admin- Update to upstream * Revert automatic setting of serange and seuser in seobject; was breaking non-MLS systems. - Add patches for sepolicy gui from mgrepl to Fix advanced_item_button_push() to allow to select an application in advanced search menu Fix previously_modified_initialize() to show modified changes properly for all selections- Update to upstream * Apply polkit check on all dbus interfaces and restrict to active user from Dan Walsh. * Fix typo in sepolicy gui dbus.relabel_on_boot call from Dan Walsh. - Apply Miroslav Grepl patch to fix TEMPLATETYPExPXL\9$V999changing in login.krb5 (#182195,#195922)- preprocess kerberos.ldif into a format FDS will like better, and include that as a doc file as well- switch man pages to being generated with the right paths in them - drop old, incomplete SELinux patch - add patch from Greg Hudson to make srvtab routines report missing-file errors at same point that keytab routines do (#241805)- pull patch from svn to undo unintentional chattiness in ftp - pull patch from svn to handle NULL krb5_get_init_creds_opt structures better in a couple of places where they're expected- update to 1.6.1 - drop no-longer-needed patches for CVE-2007-0956,CVE-2007-0957,CVE-2007-1216 - drop patch for sendto bug in 1.6, fixed in 1.6.1- kadmind.init: don't fail outright if the default principal database isn't there if it looks like we might be using the kldap plugin - kadmind.init: attempt to extract the key for the host-specific kadmin service when we try to create the keytab- omit dependent libraries from the krb5-config --libs output, as using shared libraries (no more static libraries) makes them unnecessary and they're not part of the libkrb5 interface (patch by Rex Dieter, #240220) (strips out libkeyutils, libresolv, libdl)- pull in keyutils as a build requirement to get the "KEYRING:" ccache type, because we've merged- fix an uninitialized length value which could cause a crash when parsing key data coming from a directory server - correct a typo in the krb5.conf man page ("ldap_server"->"ldap_servers")- move the default acl_file, dict_file, and admin_keytab settings to the part of the default/example kdc.conf where they'll actually have an effect (#236417)- merge security fixes from RHSA-2007:0095- add patch to correct unauthorized access via krb5-aware telnet daemon (#229782, CVE-2007-0956) - add patch to fix buffer overflow in krb5kdc and kadmind (#231528, CVE-2007-0957) - add patch to fix double-free in kadmind (#231537, CVE-2007-1216)- back out buildrequires: keyutils-libs-devel for now- add buildrequires: on keyutils-libs-devel to enable use of keyring ccaches, dragging keyutils-libs in as a dependency- fix bug ID in changelog* Thu Mar 15 2007 Nalin Dahyabhai 1.5-21 - add preliminary patch to fix buffer overflow in krb5kdc and kadmind (#231528, CVE-2007-0957) - add preliminary patch to fix double-free in kadmind (#231537, CVE-2007-1216)- add patch to build semi-useful static libraries, but don't apply it unless we need them- temporarily back out %post changes, fix for #143289 for security update - add preliminary patch to correct unauthorized access via krb5-aware telnet- make profile.d scriptlets mode 644 instead of 755 (part of #225974)- clean up quoting of command-line arguments passed to the krsh/krlogin wrapper scripts- initial update to 1.6, pre-package-reorg - move workstation daemons to a new subpackage (#81836, #216356, #217301), and make the new subpackage require xinetd (#211885)- make use of install-info more failsafe (Ville Skyttä, #223704) - preserve timestamps on shell scriptlets at %install-time- move to using pregenerated PDF docs to cure multilib conflicts (#222721)- update backport of the preauth module interface (part of #194654)- apply fixes from Tom Yu for MITKRB5-SA-2006-002 (CVE-2006-6143) (#218456) - apply fixes from Tom Yu for MITKRB5-SA-2006-003 (CVE-2006-6144) (#218456)- update backport of the preauth module interface- update backport of the preauth module interface - add proposed patches 4566, 4567 - add proposed edata reporting interface for KDC - add temporary placeholder for module global context fixes- don't bail from the KDC init script if there's no database, it may be in a different location than the default (fenlason) - remove the [kdc] section from the default krb5.conf -- doesn't seem to have been applicable for a while- rename krb5.sh and krb5.csh so that they don't overlap (#210623) - way-late application of added error info in kadmind.init (#65853)- add backport of in-development preauth mxȒXjLz$jzy{ 2.5.1 + update release notes (Jaroslav Mracek) - Fix: dnf update --refresh fails for repo_gpgcheck=1 (RhBug:1456419) (Daniel Mach) - Don't try to cut datetime message (Jaroslav Rohel) - Use localized datetime format (RhBug:1445021) (Jaroslav Rohel) - Work with locale date (Jaroslav Rohel) - Use ISO 8601 time format in logfile (Jaroslav Rohel) - Add unitest to prevent callbacks breakage (Jaroslav Mracek) - Provide compatibility for tools that do not use total_drpms (Jaroslav Mracek) - Requires strict usage of repoquery --recursive (Jaroslav Mracek) - Fix output for --resolve with --installed for repoquery (Jaroslav Mracek) - Remove unnecessary inheritance of yum conf options (Martin Hatina) - Remove alwaysprompt option support (RhBug:1400714) (Jaroslav Rohel) - Allow to install groups with multilib_policy=all (RhBug:1250702) (Jaroslav Mracek) - Redesign Base.install() to provide alternatives (Jaroslav Mracek) - Report excludes includes into logger.debug (RhBug:1381988) (Jaroslav Mracek) - Provide new API to parse string to NEVRA () (Jaroslav Mracek) - Add more repoquery querytags (Jaroslav Rohel) - Not hide tracebacks (Jaroslav Mracek) - Solve error handling for get attr in yumdb (RhBug:1397848) (Jaroslav Mracek) - Provide a better error if throttle to low (RhBug:1321407) (Jaroslav Mracek) - Change timeout to 30s (RhBug:1291867) (Jaroslav Mracek) - Add pre_transaction hook for plugins (Jaroslav Rohel) - Not download metadata if "dnf history [info|list|userinstalled]" (Jaroslav Mracek) - Not download metadata if "dnf repo-pkgs list --installed" (Jaroslav Mracek) - Not download metadata if "dnf list --installed" (RhBug:1372895) (Jaroslav Mracek) - Format pkg str for repoquery --tree due to -qf (RhBug:1444751) (Jaroslav Mracek)- Update release notes (Jaroslav Mracek) - Change documentation for history --userinstalled (RhBug:1370062) (Jaroslav Mracek) - Change example to install plugin using versionlock (Jaroslav Mracek) - Remove unused method Goal.best_run_diff() (Jaroslav Mracek) - Change recommendations if some problems appear (RhBug:1293067) (Jaroslav Mracek) - Report problems for goals with optional=True (Jaroslav Mracek) - Format resolve problem messages in method in dnf.util (Jaroslav Mracek) - Enhance reports about broken dep (RhBug:1398040)(RhBug:1393814) (Jaroslav Mracek) - search: do not generate error if not match anything (RhBug:1342157) (Jaroslav Rohel) - Check if any plugin is removed in transaction (RhBug:1379906) (Jaroslav Mracek) - Show progress for DRPM (RhBug:1198975) (Jaroslav Mracek) - Fix disabledplugin option (Iavael) - [history]: fixed info command merged output (Eduard Čuba)- bump version to 2.4.1 + update release notes (Jaroslav Mracek) - goal: do not mark weak dependencies as userinstalled (Igor Gnatenko) - fix typo in supplements (RhBug:1446756) (Igor Gnatenko) - Describe present behavior of installonly_limit conf option (Jaroslav Mracek) - Reset all transaction for groups if Base.reset() (RhBug:1446432) (Jaroslav Mracek) - Explain how add negative num for --latest-limit (RhBug:1446641) (Jaroslav Mracek) - trivial: don't duplicate option names (Igor Gnatenko) - Add support for --userinstalled for repoquery command (RhBug:1278124) (Jaroslav Rohel) - Fix header of search result sections (RhBug:1301868) (Jaroslav Rohel) - Filter out src for get_best_selector (Jaroslav Mracek) - Add minor changes in formating of documentation (Jaroslav Mracek)- po: Update translations (Igor Gnatenko) - po: Update translations (Igor Gnatenko) - introduce '--enableplugin' option (Martin Hatina) - Improve detection of file patterns (Jaroslav Mracek) - Add method _get_nevra_solution() for subject (Jaroslav Mracek) - Do not add "*" into query filter in _nevra_to_filters() (Jaroslav Mracek) - Remove usage of nevra_possibilities_real() (Jaroslav Mracek) - Increase performance for downgrade_to() (Jaroslav Mracek) - Add additional keys for get_best_query() (Jaroslav Mracek) - Increase performance for get_best_selector() (Jaroslav Mracek) - Increase performance fx@X Ln D$DDJ ?$d  ? /;djt              Lt    !(.889X:G ( H P I x X Y \ ] ^ .b d je of rl tt u v w h x y     48   ghCperl-Math-BigRat0.26141.el8Arbitrary big rational numbersMath::BigRat complements Math::BigInt and Math::BigFloat by providing support for arbitrary big rational numbers.]build.cloudlinux.comZCloudLinuxCloudLinuxGPL+ or ArtisticCloudLinux Packaging Team Unspecifiedhttp://search.cpan.org/dist/Math-BigRat/linuxnoarch~E(mg6A큤A큤A큤]X>NZ.X=Z]X?]]Z80b94dc139aebd846199b4b2cc0b15ada16066fdfbd96bac7f603d2fcfba54d44a65ca291fd7c218e5858ea8cc6abd395f5fe7657dadce0f7bf24f0f4f0328a181b33f112a14d61bc5d010ae31b6c2a3385b94bcb994f74d6edc41b7fa9e5cc514326b2fa3ca46316870b8952ac20f50e2f7423547f6b9ecee51ea086eb6ff93b857edab549ac6893e2df5e1ec768ee46b62bcf1607a55e876f4d23f079eaccef75af051a62f409b1c38e282bb59c7001920fd7d87a1a8485f874a68d475430a3aa4ec65b9a391dd9fa037f778c6abd3d97d396bf7ddc61334bd44255b597dd2rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-Math-BigRat-0.2614-1.el8.src.rpmperl(Math::BigRat)perl-Math-BigRat@ @@ @@@    perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(Carp)perl(Math::BigFloat)perl(Math::BigInt)perl(overload)perl(strict)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)5.6.01.9997181.9997183.0.4-14.6.0-14.0-15.2-1perl4:5.22.0-3484.14.2Z3@Z|;YyYGY2X @XX]Petr Pisar - 0.2614-1Fedora Release Engineering - 0.2613-3Fedora Release Engineering - 0.2613-2Petr Pisar - 0.2613-1Jitka Plesnikova - 0.2612-2Petr Pisar - 0.2612-1Fedora Release Engineering - 0.2611-2Petr Pisar 0.2611-1- 0.2614 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- 0.2613 bump- Perl 5.26 rebuild- 0.2612 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Specfile autogenerated by cpanspec 1.78. 0.26140.2614-1.el8perl-Math-BigRatBUGSCHANGESREADMETODOperl-Math-BigRatLICENSEMath::BigRat.3pm.gzMathBigRat.pm/usr/share/doc//usr/share/doc/perl-Math-BigRat//usr/share/licenses//usr/share/licenses/perl-Math-BigRat//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/Math/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBxqX  LPO$_OP?x NYb k  l p |     (1X8Y@ hmQGiBEeD8koRBACC1VBRsUwGr9gxFFRho9kZpdRUjBJoPhkeOTvp9LzkdAQMFngr BFi6N0ov1kCX7LLwBmDG+JPR7N+XcH9YR1coSHpLVg+JNy2kFDd4zAyWxJafjZ3a 9zFg9Yx+0va1BJ2t4zVcmKS4aOfbgQ5KwIOWUujalQW5Y+Fw39Gn86qjbwCg5dIo tkM0l19h2sx50D027pV5aPsD/2c9pfcFTbMhB0CcKS836GH1qY+NCAdUwPs646ee Ex/k9Uy4qMwhl3HuCGGGa+N6Plyon7V0TzZuRGp/1742dE8IO+I/KLy2L1d1Fxrn XOTBZd8qe6nBwh12OMcKrsPBVBxn+iSkaG3ULsgOtx+HHLfa1/p22L5+GzGdxizr peBuA/90cCp+lYcEwdYaRoFVR501yDOTmmzBc1DrsyWP79QMEGzMqa393G0VnqXt L4pGmunq66Agw2EhPcIt3pDYiCmEt/obdVtSJH6BtmSDB/zYhbE8u3vLP3jfFDa9 KXxgtYj0NvuUVoRmxSKm8jtfmj1L7zoKNz3jl+Ba3L0WxIv4+bRBUG9zdGdyZVNR TCBSUE0gQnVpbGRpbmcgUHJvamVjdCA8cGdzcWxycG1zLWhhY2tlcnNAcGdmb3Vu ZHJ5Lm9yZz6IYAQTEQIAIAUCR4PySgIbIwYLCQgHAwIEFQIIAwQWAgMBAh4BAheA AAoJEB8W0uFELfD4jnkAoMqd6ZwwsgYHZ3hP9vt+DJt1uDW7AKDbRwP8ESKFhwdJ 8m91RPBeJW/tMLkCDQRHg/JKEAgA64+ZXgcERPYfZYo4p+yMTJAAa9aqnE3U4Ni6 ZMB57GPuEy8NfbNya+HiftO8hoozmJdcI6XFyRBCDUVCdZ8SE+PJdOx2FFqZVIu6 dKnr8ykhgLpNNEFDG3boK9UfLj/5lYQ3Y550Iym1QKOgyrJYeAp6sZ+Nx2PavsP3 nMFCSD67BqAbcLCVQN7a2dAUXfEbfXJjPHXTbo1/kxtzE+KCRTLdXEbSEe3nHO04 K/EgTBjeBUOxnciH5RylJ2oGy/v4xr9ed7R1jJtshsDKMdWApwoLlCBJ63jg/4T/ z/OtXmu4AvmWaJxaTl7fPf2GqSqqb6jLCrQAH7AIhXr9V0zPZwADBQgAlpptNQHl u7euIdIujFwwcxyQGfee6BG+3zaNSEHMVQMuc6bxuvYmgM9r7aki/b0YMfjJBk8v OJ3Eh1vDH/woJi2iJ13vQ21ot+1JP3fMd6NPR8/qEeDnmVXu7QAtlkmSKI9Rdnjz FFSUJrQPHnKsH4V4uvAM+njwYD+VFiwlBPTKNeL8cdBb4tPN2cdVJzoAp57wkZAN VA2tKxNsTJKBi8wukaLWX8+yPHiWCNWItvyB4WCEp/rZKG4A868NM5sZQMAabpLd l4fTiGu68OYgK9qUPZvhEAL2C1jPDVHPkLm+ZsD+90Pe66w9vB00cxXuHLzm8Pad GaCXCY8h3xi6VIhJBBgRAgAJBQJHg/JKAhsMAAoJEB8W0uFELfD4K4cAoJ4yug8y 1U0cZEiF5W25HDzMTtaDAKCaM1m3Cbd+AZ0NGWNg/VvIX9MsPA== gpg-pubkey442df0f84783f24agpg(PostgreSQL RPM Building Project )-----BEGIN PGP PUBLIC KEY BLOCK----- Version: rpm-4.11.3 (NSS-3) mQGiBEeD8koRBACC1VBRsUwGr9gxFFRho9kZpdRUjBJoPhkeOTvp9LzkdAQMFngr BFi6N0ov1kCX7LLwBmDG+JPR7N+XcH9YR1coSHpLVg+JNy2kFDd4zAyWxJafjZ3a 9zFg9Yx+0va1BJ2t4zVcmKS4aOfbgQ5KwIOWUujalQW5Y+Fw39Gn86qjbwCg5dIo tkM0l19h2sx50D027pV5aPsD/2c9pfcFTbMhB0CcKS836GH1qY+NCAdUwPs646ee Ex/k9Uy4qMwhl3HuCGGGa+N6Plyon7V0TzZuRGp/1742dE8IO+I/KLy2L1d1Fxrn XOTBZd8qe6nBwh12OMcKrsPBVBxn+iSkaG3ULsgOtx+HHLfa1/p22L5+GzGdxizr peBuA/90cCp+lYcEwdYaRoFVR501yDOTmmzBc1DrsyWP79QMEGzMqa393G0VnqXt L4pGmunq66Agw2EhPcIt3pDYiCmEt/obdVtSJH6BtmSDB/zYhbE8u3vLP3jfFDa9 KXxgtYj0NvuUVoRmxSKm8jtfmj1L7zoKNz3jl+Ba3L0WxIv4+bRBUG9zdGdyZVNR TCBSUE0gQnVpbGRpbmcgUHJvamVjdCA8cGdzcWxycG1zLWhhY2tlcnNAcGdmb3Vu ZHJ5Lm9yZz6IYAQTEQIAIAUCR4PySgIbIwYLCQgHAwIEFQIIAwQWAgMBAh4BAheA AAoJEB8W0uFELfD4jnkAoMqd6ZwwsgYHZ3hP9vt+DJt1uDW7AKDbRwP8ESKFhwdJ 8m91RPBeJW/tMLkCDQRHg/JKEAgA64+ZXgcERPYfZYo4p+yMTJAAa9aqnE3U4Ni6 ZMB57GPuEy8NfbNya+HiftO8hoozmJdcI6XFyRBCDUVCdZ8SE+PJdOx2FFqZVIu6 dKnr8ykhgLpNNEFDG3boK9UfLj/5lYQ3Y550Iym1QKOgyrJYeAp6sZ+Nx2PavsP3 nMFCSD67BqAbcLCVQN7a2dAUXfEbfXJjPHXTbo1/kxtzE+KCRTLdXEbSEe3nHO04 K/EgTBjeBUOxnciH5RylJ2oGy/v4xr9ed7R1jJtshsDKMdWApwoLlCBJ63jg/4T/ z/OtXmu4AvmWaJxaTl7fPf2GqSqqb6jLCrQAH7AIhXr9V0zPZwADBQgAlpptNQHl u7euIdIujFwwcxyQGfee6BG+3zaNSEHMVQMuc6bxuvYmgM9r7aki/b0YMfjJBk8v OJ3Eh1vDH/woJi2iJ13vQ21ot+1JP3fMd6NPR8/qEeDnmVXu7QAtlkmSKI9Rdnjz FFSUJrQPHnKsH4V4uvAM+njwYD+VFiwlBPTKNeL8cdBb4tPN2cdVJzoAp57wkZAN VA2tKxNsTJKBi8wukaLWX8+yPHiWCNWItvyB4WCEp/rZKG4A868NM5sZQMAabpLd l4fTiGu68OYgK9qUPZvhEAL2C1jPDVHPkLm+ZsD+90Pe66w9vB00cxXuHLzm8Pad GaCXCY8h3xi6VIhJBBgRAgAJBQJHg/JKAhsMAAoJEB8W0uFELfD4K4cAoJ4yug8y 1U0cZEiF5W25HDzMTtaDAKCaM1m3Cbd+AZ0NGWNg/VvIX9MsPA== =au6K -----END PGP PUBLIC KEY BLOCK----- GJlocalhostpubkeyPostgreSQL RPM Building Project Public Keys(none)gpg(PostgreSQL RPM Building Project )gpg(442df0f8)4.11.34:1f16d2e1442df0f8-4783f24a4:1f16d2e1442df0f8-4783f24a?f98488x0aX L(}X;$;;;vesh Agarwal - 5.02-1Fedora Release Engineering - 5.01-3Avesh Agarwal - 5.01-2Avesh Agarwal - 5.01-1Avesh Agarwal - 5.00-1Avesh Agarwal - 4.56-3Fedora Release Engineering - 4.56-2Avesh Agarwal - 4.56-1Avesh Agarwal - 4.55-2Avesh Agarwal - 4.55-1Fedora Release Engineering - 4.54-3Avesh Agarwal - 4.54-2Avesh Agarwal - 4.54-1Fedora Release Engineering - 4.53-2Avesh Agarwal - 4.53-1Avesh Agarwal - 4.52-1Fedora Release Engineering - 4.50-2Avesh Agarwal - 4.50-1Avesh Agarwal - 4.44-1Avesh Agarwal - 4.42-1Avesh Agarwal - 4.41-1Avesh Agarwal - 4.37-1Avesh Agarwal - 4.35-1Fedora Release Engineering - 4.34-2Avesh Agarwal - 4.34-1Avesh Agarwal - 4.33-1Avesh Agarwal - 4.32-1Avesh Agarwal - 4.31-1Avesh Agarwal - 4.30-1Avesh Agarwal - 4.29-1Tomas Mraz - 4.27-5Fedora Release Engineering - 4.27-4Miloslav Trmač - 4.27-3Miloslav Trmač - 4.27-2Miloslav Trmač - 4.27-1Fedora Release Engineering - 4.26-3Tomas Mraz - 4.26-2Miloslav Trmač - 4.26-1Miloslav Trmač - 4.25-2Miloslav Trmač - 4.25-1Miloslav Trmač - 4.24-2Miloslav Trmač - 4.24-1Miloslav Trmač - 4.22-1Fedora Release Engineering - 4.20-6Miloslav Trmač - 4.20-5Miloslav Trmač - 4.20-4Miloslav Trmač - 4.20-3.nssMiloslav Trmac - 4.20-2Miloslav Trmac - 4.20-1Miloslav Trmac - 4.19-1Miloslav Trmac - 4.18-1Jesse Keating - 4.15-2Jesse Keating - 4.15-1.1Miloslav Trmac - 4.15-1Jesse Keating - 4.14-3.2Jesse Keating - 4.14-3.1Miloslav Trmac - 4.14-3Jesse Keating Miloslav Trmac - 4.14-2Miloslav Trmac - 4.14-1Miloslav Trmac - 4.13-1Miloslav Trmac - 4.12-1Miloslav Trmac - 4.11-2Miloslav Trmac - 4.11-1Miloslav Trmac - 4.10-2Nalin Dahyabhai 4.10-1Nalin Dahyabhai 4.08-2Nalin Dahyabhai 4.08-1Miloslav Trmac - 4.05-4Elliot Lee Nalin Dahyabhai 4.05-2Nalin Dahyabhai 4.05-1Elliot Lee Elliot Lee Elliot Lee 4.04-6Elliot Lee Nalin Dahyabhai 4.04-4Nalin Dahyabhai 4.04-3Tim Powers Nalin Dahyabhai 4.04-1Nalin Dahyabhai 4.03-1Nalin Dahyabhai Nalin Dahyabhai 4.02-1Nalin Dahyabhai 4.00-1Nalin Dahyabhai Tim Powers Tim Powers Nalin Dahyabhai 3.22-2Nalin Dahyabhai 3.22-1Nalin Dahyabhai 3.21a-1Nalin Dahyabhai 3.20-1NalixPX L(/I$I ? ?xd" . :dh     V X`jt 8(89:'GHIXY$\P]X^fbdGeLfOlQtlutv|(,2t    g h Ccpanel-perl-542-digest-md22.041.cp130~el8CPAN moduleCpanel build perl module 'Digest::MD2'h~Xbh-centos-8.dev.cpanel.netKperlcpanel/perlhttps://metacpan.orglinuxx86_64AFX$$h~Wh~X93007a45ed817b676b10ace3daeddaade9e1c757d056c67395f58c9730d67ee908653d724417857289a8db340c394ec0cf4d63f33ee084f0c27ef077e703281erootrootrootrootcpanel-perl-542-digest-md2-2.04-1.cp130~el8.src.rpmcpanel-perl(Digest::MD2)cpanel-perl-542-digest-md2cpanel-perl-542-digest-md2(x86-64)cpanel-perl-digest-md2     cpanel-perl-542rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@Yx@V<@Q+R@Busy Camels - 2.04-1.cp130Busy Camels - 2.04-1.cp108Busy Camels - 2.04-1.cp1198Nicolas Rochelemagne - 2.04-1.cp1162Todd Rinaldo - 2.04-1.cp1156Todd Rinaldo - 2.03-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update patches: Digest-MD2 2.04- Update from upstream: Digest-MD2 2.04- Update from upstream: Digest-MD2 2.032.042.04-1.cp130~el82.04-1.cp130~el82.04MD2.pmMD2.so/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/x86_64-linux/Digest//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/x86_64-linux/auto/Digest/MD2/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuPerl5 module source textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b5505014ae49411009414fdf7b661def901ae5d4, not strippedutf-8f494bd8b81566f7284f114d3744342156ed3e863bb56cb1fe1af6f0ac22b2952?%l՜ ]8Irx64d0e966a93bd741cf3194e7b7d32a0f2cd128b3a3d1455ce678bdb9b49a41cc8aff711b231daa902a289f7f112ec7cd7eb85fe9j{mMj{Uperl-536-specio-library-numericnts8l   i'cpanel-perl-536-specio-library-builtins (l  ucpanel-perl-536-specio-exporterxt8l n  acpanel-perl-536-specio-declareuse(l  ocpanel-perl-536-specioppof)cpanel-perl-536-sort-versions` } -  ! acpanel-perl-536-socketethDcpanel-perl-536-set-crontabmdR$ rcpanel-perl-536-sereal-encoderMakR$ Lcpanel-perl-536-sereal-decoderLDFx @X  L8|G;$;;;Recognize all Unicode space characters with /x option in a pattern (bug #1617960) - Fix changing dynamic options (bug #1617960) - Fix autopossessifying a repeated negative class with no characters less than 256 that is followed by a positive class with only characters less than 255, (bug #1617960) - Fix autopossessifying a repeated negative class with no characters less than 256 that is followed by a positive class with only characters less than 256, (bug #1617960)- Fix backtracking atomic groups when they are not separated by something with a backtracking point- Fix checking that a lookbehind assertion has a fixed length if the lookbehind assertion is used inside a lookahead assertion - Fix parsing VERSION conditions- Fix global search/replace in pcre2test and pcre2_substitute() when the pattern matches an empty string, but never at the starting offset- Fix bug when \K is used in a lookbehind in a substitute pattern- Fix setting error offset zero for early errors in pcre2_pattern_convert()- Add support to pcre2grep for binary zeros in -f files (upstream bug #2222) - Fix compiler warnings in pcre2grep- Fix returning unset groups in POSIX interface if REG_STARTEND has a non-zero starting offset (upstream bug #2244) - Fix pcre2test -C to correctly show what \R matches - Fix matching repeated character classes against an 8-bit string containting multi-code-unit characters- 10.31 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Fix auto-possessification at the end of a capturing group that is called recursively (upstream bug #2232)- Enlarge ovector array match data structure to be large enough in all cases (oss-fuzz #5415)- 10.31-RC1 bump- Fix handling \K in an assertion in pcre2grep tool and documentation (upstream bug #2211) - Fix matching at a first code unit of a new line sequence if PCRE2_FIRSTLINE is enabled- Fix pcre2_jit_match() to properly check the pattern was JIT-compiled - Allow pcre2grep match counter to handle values larger than 2147483647, (upstream bug #2208) - Fix incorrect first matching character when a backreference with zero minimum repeat starts a pattern (upstream bug #2209)- Fix multi-line matching in pcre2grep tool (upstream bug #2187)- Accept files names longer than 128 bytes in recursive mode of pcre2grep (upstream bug #2177)- 10.30 bump- Disable SELinux-friendly JIT allocator because it crashes after a fork (upstream bug #1749)- Fix handling a hyphen at the end of a character class (upstream bug #2153)- Rebuild with binutils fix for ppc64le (#1475636)- Fix applying local x modifier while global xx was in effect- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Fix a compiler warning in JIT code for ppc32- 10.30-RC1 bump - Heap-based matching implementation replaced stack-based one - SELinux-friendly JIT enabled- Fix DFA matching a lookbehind assertion that has a zero-length branch (PCRE2 oss-fuzz issue 1859) - Fix returned offsets from regexec() when REG_STARTEND is used with starting offset greater than zero (upstream bug #2128)- Fix a pcre2test crash on multiple push statements (upstream bug #2109)- Fix CVE-2017-7186 in JIT mode (a crash when finding a Unicode property for a character with a code point greater than 0x10ffff in UTF-32 library while UTF mode is disabled) (bug #1434504) - Fix an incorrect cast in UTF validation (upstream bug #2090)- Fix DFA match for a possessively repeated character class (upstream bug #2086) - Use a memory allocator from the pattern if no context is supplied to pcre2_match()- Close serialization file in pcre2test after any error (upstream bug #2074) - Fix a memory leak in pcre2_serialize_decode() when the input is invalid (upstream bug #2075) - Fix a potential NULL dereference in pcre2_callout_enumerate() if called with a NULL pattern pointer when Unicode support is available (upstream bug #2076) - Fix CVE-2017-8786 (32-bit error buffer size bug in pcre2test) (bug #1500717)- Fix an intx8/XL}b$F7?2d , m  &0D N X l  <PiT(R8\?9X?:?F.dG.xH.I.X.Y.\.]/^/Tb/c1/d1e1f1l1t1u1v1z2s2222225 5 7(7Q777g7h7Cea-php81-php-fileinfo8.1.343.8.3.cpanelEOL A module for PHP applications that need to detect file typesphp 8.1 has reached End of Life. The php-fileinfo package delivers a module which will allow PHP scripts to try to guess the content type and encoding of a file by looking for certain magic byte sequences at specific positions within the file. While this is not a bullet proof approach the heuristics used do a very good job.jhou-2m!EA4-production / CentOS_8cPanel, Inc.PHPDevelopment/Languageshttps://endoflife.date/phplinuxx86_649mFAAjjjjjb0075e0522dc1baf4c164c804f9efb4e4e9be7db8d75073a0362356bcb9160bbd5d1d6d785b191560925cea1992cabc7dbc93e5e02f01a4ea05a24311b3a085d../../../../opt/cpanel/ea-php81/root/usr/lib64/php/modules/fileinfo.sorootrootrootrootrootrootrootrootrootrootea-php81-php-8.1.34-3.8.3.cpanel.src.rpmconfig(ea-php81-php-fileinfo)ea-php81-php-fileinfoea-php81-php-fileinfo(x86-64)@@@@@@@@    @config(ea-php81-php-fileinfo)ea-php81-php-cli(x86-64)ea-php81-php-common(x86-64)libargon2.so.0()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)8.1.34-3.8.3.cpanel8.1.34-3.8.3.cpanel8.1.34-3.8.3.cpanel3.0.4-14.6.0-14.0-15.2-14.14.3iC@i`iChҋhh@hfpgg}@g? g@fLfo@fKfaff"@e @ee4@ehy@ee@e`@e;@ed d˖d@ddu@df@dddcp@d^*@d>@d9@@dc@c@c@cc\cr-c[@c5c5c1@cbbbb|bX b3"b\@b@a@aՈ@a@aa{aaa@Brian Mendoza - 8.1.34-3Gary Stanley - 8.1.34-2Dan Muey - 8.1.34-1Chris Castillo - 8.1.33-3Dan Muey - 8.1.33-2Cory McIntire - 8.1.33-1Cory McIntire - 8.1.32-1Dan Muey - 8.1.31-2Cory McIntire - 8.1.31-1Julian Brown - 8.1.30-2Cory McIntire - 8.1.30-1Dan Muey - 8.1.29-3Julian Brown - 8.1.29-2Cory McIntire - 8.1.29-1Brian Mendoza - 8.1.28-2Cory McIntire - 8.1.28-1Brian Mendoza - 8.1.27-2Travis Holloway - 8.1.27-1Travis Holloway - 8.1.26-4Tim Mullin - 8.1.26-3Julian Brown - 8.1.26-2Cory McIntire - 8.1.26-1Cory McIntirxXL"8/$,sh. * Merged chcat script and man page from Dan Walsh.- Update to match NSA - Add gfs support- Update to match NSA - Add chcat to policycoreutils, adding +/- syntax `- Require new version of libsemanage- Update to match NSA * Changed genhomedircon to warn on use of ROLE in homedir_template if using managed policy, as libsemanage does not yet support it.- Update to match NSA * Merged genhomedircon bug fix from Dan Walsh. * Revised semodule* man pages to refer to checkmodule and to include example sections.- Update to match NSA * Merged audit2allow --tefile and --fcfile support from Dan Walsh. * Merged genhomedircon fix from Dan Walsh. * Merged semodule* man pages from Dan Walsh, and edited them. * Changed setfiles to set the MATCHPATHCON_VALIDATE flag to retain validation/canonicalization of contexts during init.- Update to match NSA * Changed genhomedircon to always use user_r for the role in the managed case since user_get_defrole is broken. - Add te file capabilities to audit2allow - Add man pages for semodule- Update to match NSA * Merged sestatus, audit2allow, and semanage patch from Dan Walsh. * Fixed semodule -v option.- Update to match NSA * Merged audit2allow python script from Dan Walsh. (old script moved to audit2allow.perl, will be removed later). * Merged genhomedircon fixes from Dan Walsh. * Merged semodule quieting patch from Dan Walsh (inverts default, use -v to restore original behavior).- Audit2allow * Add more error checking * Add gen policy package * Add gen requires- Update to match NSA * Merged genhomedircon rewrite from Dan Walsh. - Rewrite audit2allow to python- Fix genhomedircon to work with non libsemanage systems- Patch genhomedircon to use libsemanage.py stuff- Update to match NSA * Merged setsebool cleanup patch from Ivan Gyurdiev.- Fix genhomedircon to use seusers file, temporary fix until swigified semanage* Added -B (--build) option to semodule to force a rebuild. * Reverted setsebool patch to call semanage_set_reload_bools(). * Changed setsebool to disable policy reload and to call security_set_boolean_list to update the runtime booleans. * Changed setfiles -c to use new flag to set_matchpathcon_flags() to disable context translation by matchpathcon_init().- Update to match NSA * Changed setfiles for the context canonicalization support. * Changed setsebool to call semanage_is_managed() interface and fall back to security_set_boolean_list() if policy is not managed. * Merged setsebool memory leak fix from Ivan Gyurdiev. * Merged setsebool patch to call semanage_set_reload_bools() interface from Ivan Gyurdiev.- Update to match NSA * Merged setsebool patch from Ivan Gyurdiev. This moves setsebool from libselinux/utils to policycoreutils, and rewrites it to use libsemanage for permanent boolean changes.- Rebuild to use latest libselinux, libsemanage, and libsepol- Update to match NSA * Merged semodule support for reload, noreload, and store options from Joshua Brindle. * Merged semodule_package rewrite from Joshua Brindle.- Update to match NSA * Cleaned up usage and error messages and releasing of memory by semodule utilities. * Corrected error reporting by semodule. * Updated semodule_expand for change to sepol interface. * Merged fixes for make DESTDIR= builds from Joshua Brindle.- Update to match NSA * Updated semodule_package for sepol interface changes.- Update to match NSA * Updated semodule_expand/link for sepol interface changes.- Update to match NSA * Merged non-PAM Makefile support for newrole and run_init from Timothy Wood.- Update to match NSA * Updated semodule_expand to use get interfaces for x(X'L(9$W999odule interface (#208643)- provide docs in PDF format instead of as tex source (Enrico Scholz, #209943)- add missing shebang headers to krsh and krlogin wrapper scripts (#209238)- set SS_LIB at configure-time so that libss-using apps get working readline support (#197044)- switch to the updated patch for MITKRB-SA-2006-001- apply patch to address MITKRB-SA-2006-001 (CVE-2006-3084)- ensure that the gssapi library's been initialized before walking the internal mechanism list in gss_release_oid(), needed if called from gss_release_name() right after a gss_import_name() (#198092)- rebuild- pull up latest revision of patch to reduce lockups in rsh/rshd- rebuild- rebuild- build- update to 1.5- mark profile.d config files noreplace (Laurent Rineau, #196447)- add buildprereq for autoconf- further munge krb5-config so that 'libdir=/usr/lib' is given even on 64-bit architectures, to avoid multilib conflicts; other changes will conspire to strip out the -L flag which uses this, so it should be harmless (#192692)- adjust the patch which removes the use of rpath to also produce a krb5-config which is okay in multilib environments (#190118) - make the name-of-the-tempfile comment which compile_et adds to error code headers always list the same file to avoid conflicts on multilib installations - strip SIZEOF_LONG out of krb5.h so that it doesn't conflict on multilib boxes - strip GSS_SIZEOF_LONG out of gssapi.h so that it doesn't conflict on mulitlib boxes- Fix formatting typo in kinit.1 (krb5-kinit-man-typo.patch)- bump again for double-long bug on ppc(64)- give a little bit more information to the user when kinit gets the catch-all I/O error (#180175)- rebuild properly when pthread_mutexattr_setrobust_np() is defined but not declared, such as with recent glibc when _GNU_SOURCE isn't being used- Use full paths in krb5.sh to avoid path lookups- rebuilt- login: don't truncate passwords before passing them into crypt(), in case they're significant (#149476)- update to 1.4.3 - make ksu setuid again (#137934, others)- mark %{krb5prefix}/man so that files which are packaged within it are flagged as %doc (#168163)- add an xinetd configuration file for encryption-only telnetd, parallelling the kshell/ekshell pair (#167535)- change the default configured encryption type for KDC databases to the compiled-in default of des3-hmac-sha1 (#57847)- update to 1.4.2, incorporating the fixes for MIT-KRB5-SA-2005-002 and MIT-KRB5-SA-2005-003- rebuild- fix telnet client environment variable disclosure the same way NetKit's telnet client did (CAN-2005-0488) (#159305) - keep apps which call krb5_principal_compare() or krb5_realm_compare() with malformed or NULL principal structures from crashing outright (Thomas Biege) (#161475)- apply fixes from draft of MIT-KRB5-SA-2005-002 (CAN-2005-1174,CAN-2005-1175) (#157104) - apply fixes from draft of MIT-KRB5-SA-2005-003 (CAN-2005-1689) (#159755)- fix double-close in keytab handling - add port of fixes for CAN-2004-0175 to krb5-aware rcp (#151612)- prevent spurious EBADF in krshd when stdin is closed by the client while the command is running (#151111)- add deadlock patch, removed old patch- update to 1.4.1, incorporating fixes for CAN-2005-0468 and CAN-2005-0469 - when starting the KDC or kadmind, if KRB5REALM is set via the /etc/sysconfig file for the service, pass it as an argument for the -r flag- drop krshd patch for now- add draft fix from Tom Yu for slc_add_reply() buffer overflow (CAN-2005-0469) - add draft fix from Tom Yu for env_opt_add() buffer overflow (CAN-2005-0468)- don't include into the telnet client when we're not using curses- update to 1.4 - v1.4 kadmin client requires a v1.4 kadmind on the server, or use the "-O" flag to specify that it should communicate with the server using the older protocol - new libkrb5support library - v5passwdd and kadmind4 are gone - versioned symbols - pick up $KRB5KDC_ARGS from /etc/sysconfig/krb5kdc, if it exists, and pass it on to krxX LcD$scDbDdDrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrxxXL0HR$$plit python into a separate package- Update to upstream * chcat: cut categories at arbitrary point (25) from Dan Walsh * semodule: use new interfaces in libsemanage for compressed files from Dan Walsh * audit2allow: string changes for usage- Don't error out when removing a non existing module- fix audit2allow man page- Fix Japanese translations- Change md5 to hashlib.md5 in sepolgen- Rebuild for Python 2.6- Fix error checking in restorecond, for inotify_add_watch- Update to upstream * semanage: use semanage_mls_enabled() from Stephen Smalley.- Rebuild for Python 2.6- Update to upstream * fcontext add checked local records twice, fix from Dan Walsh.- Update to upstream * Allow local file context entries to override policy entries in semanage from Dan Walsh. * Newrole error message corrections from Dan Walsh. * Add exception to audit2why call in audit2allow from Dan Walsh.- add compression- Move the usermode-gtk requires to the -gui subpackage.- Fix traceback in audit2why- Make GUI use translations- Fix typo in man page- Handle selinux disabled correctly - Handle manipulation of fcontext file correctly- Add usermode-gtk requires- Allow addition of local modifications of fcontext policy.- Fix system-config-selinux booleanspage throwing and exception - Update po files- Fix text in newrole - Fix revertbutton on booleans page in system-config-selinux- Change semodule calls for libsemanage- Update to upstream * Update po files from Dan Walsh.- Fix semanage help display - Update to upstream * fixfiles will now remove all files in /tmp and will check for unlabeled_t in /tmp and /var/tmp from Dan Walsh. * add glob support to restorecond from Dan Walsh. * allow semanage to handle multi-line commands in a single transaction from Dan Walsh.- Only call gen_requires once in sepolgen- Change Requires line to gnome-python2-gnome - Fix spelling mistakes - Require libselinux-utils- Add node support to semanage- Fix fixfiles to correct unlabeled_t files and remove .? files- Add glob support to restorecond so it can check every file in the homedir- Update to upstream * Merged semanage node support from Christian Kuester.- Add require libsemanage-python- Add missing html_util.py file- Fixes for multiple transactions- Allow multiple transactions in one semanage command- Update to upstream * Add support for boolean files and group support for seusers from Dan Walsh. * Ensure that setfiles -p output is newline terminated from Russell Coker.- Allow semanage user to add group lists % groupname- Fix help- Update to upstream * Change setfiles to validate all file_contexts files when using -c from Stephen Smalley.- Fix boolean handling - Upgrade to latest sepolgen - Update po patch- Additial cleanup of boolean handling for semanage- Handle ranges of ports in gui- Fix indent problems in seobject- Add lockdown wizard - Allow semanage booleans to take an input file an process lots of booleans at once.- Default prefix to "user"- Remove semodule use within semanage - Fix launching of polgengui from toolbar- Update to upstream * Fix audit2allow generation of role-type rules from Karl MacMillan.- Fix spelling of enforcement- Fix sepolgen/audit2allow handling of roles- Fix sepolgen-ifgen processing- Add deleteall to semanage permissive, cleanup error handling- Complete removal of rhpl requirement- Add semanage permissive *- Fix fixfiles to cleanup /tmp and /var/tmp- Fix listing of types in gui- Update to upstream * Remove security_check_context calls for prefix validation from semanage. * Change setfiles and restorecon to not relabel if the file already has the correct context value even if -F/force is specified.- Remove /usr/share/locale/sr@Latn/LC_MESSAGES/policycoreutils.mo- Add rm -rf /tmp/gconfd-* /tmp/pulse-* /tmp/orbit-* to fixfiles restore - So that mislabeled files will get removedxX L{;$;;;ernal error for a forward reference in a lookbehind with PCRE2_ANCHORED (oss-fuzz bug #865) - Fix a pcre2test bug for global match with zero terminated subject (upstream bug #2063)- Handle memmory allocation failures in pcre2test tool - Fix CVE-2017-7186 (a crash when finding a Unicode property for a character with a code point greater than 0x10ffff in UTF-32 library while UTF mode is disabled) (upstream bug #2052)- 10.23 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- 10.23-RC1 bump- Rebuild for readline 7.x- Fix an out-of-bound read in pcre2test tool within POSIX mode (upstream bug #2008)- Fix compiling a class with UCP and without UTF- Fix a crash when doing an extended substitution for \p, \P, or \X (upstream bug #1977) - Fix a crash in substitution if starting offest was specified beyond the subject end (upstream bug #1992)- Fix pcre2-config --libs-posix output (upstream bug #1924) - Fix a memory leak and a typo in a documentation (upstream bug #1973) - Fix a buffer overflow in partial match test for CRLF in an empty buffer (upstream bug #1975) - Fix a crash in pcre2test when displaying a wide character with a set locate (upstream bug #1976)- Fix faulty auto-anchoring patterns when .* is inside an assertion- Document assert capture limitation (upstream bug #1887) - Ignore offset modifier in pcre2test in POSIX mode (upstream bug #1898)- Disable the JIT on riscv64.- Fix displaying a callout position in pcretest output with an escape sequence greater than \x{ff} - Fix pcrepattern(3) documentation - Fix miscopmilation of conditionals when a group name start with "R" (upstream bug #1873) - Fix internal option documentation in pcre2pattern(3) (upstream bug #1875) - Fix optimization bugs for patterns starting with lookaheads (upstream bug #1882)- Fix matching characters above 255 when a negative character type was used without enabled UCP in a positive class (upstream bug #1866)- 10.22 bump- 10.22-RC1 bump - libpcre2-posix library changed ABI - Fix register overwite in JIT when SSE2 acceleration is enabled - Correct pcre2unicode(3) documentation- Fix repeated pcregrep output if -o with -M options were used and the match extended over a line boundary (upstream bug #1848)- Fix a race in JIT locking condition - Fix an ovector check in JIT test program - Enable JIT in the pcre2grep tool- Ship README in devel as it covers API and build, not general info - Move UTF-16 and UTF-32 libraries into pcre-ut16 and pcre-32 subpackages- Fix a typo in pcre2_study()- Report unmatched closing parantheses properly - Fix pcre2test for expressions with a callout inside a look-behind assertion (upstream bug #1783) - Fix CVE-2016-3191 (workspace overflow for (*ACCEPT) with deeply nested parentheses) (upstream bug #1791)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- 10.21 bump- Adapt a test to French locale on RHEL- 10.21-RC1 bump- Fix compiling patterns with PCRE2_NO_AUTO_CAPTURE (upstream bug #1704)- Fix compiling classes with a negative escape and a property escape (upstream bug #1697) - Fix integer overflow for patterns whose minimum matching length is large (upstream bug #1699)- 10.20 bump- 10.20-RC1 bump - Replace dependency on glibc-headers with gcc (bug #1230479) - Preserve soname- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- fixed Release field- Backport fix for AArch64- Package pcre2demo.c as a documentation for pcre2-devel- PCRE2 library packaged 10.32-3.el8_610.32-3.el8_6.build-idda5dc4d9437e3807fc9d52d06ad610f194015d53fb6f8c4e86e8c48432f60eb77b33905491b2c5bflibpcre2-8.so.0libpcre2-8.so.0.7.1libpcre2-posix.so.2libpcre2-posix.so.2.0.1pcre2AUTHORSChangeLogNEWSpcre2COPYINGLICENCE/usr/lib//usr/lib/.build-id//usr/lib/.build-id/daxhX L] ZOJ$_OJ ??Ld! - Utx     5 8<AFtx4(Z8d 9 : GHIXY \4]8^CbvdefltuvH\` pghCcpanel-requirejs-devel2.3.7.11.cp130~el8Development tools related to requirejs.Debug version of requirejs.h bh-centos-8.dev.cpanel.netS MIT, new BSDHTML/JS/CSShttps://requirejs.org/docs/download.htmllinuxnoarchS hd76fb613c88771d68cb79ac4c024ff31c549e1b12bcb02f76269ad4e5e68bb89rootrootcpanel-requirejs-2.3.7.1-1.cp130~el8.src.rpmcpanel-requirejs-devel     cpanel-requirejsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h@h@h5@bL@`3@]µSuSuSy@SM@Tim Mullin - 2.3.7.1-1.cp130~el8Tim Mullin - 2.3.7-1.cp130Thomas "Andy" Baugh - 2.1.14-1.cp130Nicolas Rochelemagne - 2.1.14-1.cp108Nicolas Rochelemagne - 2.1.14-1.cp1198Nicolas Rochelemagne - 2.1.14-1.cp1186Tom Green - 2.1.14-1.cp1146Tom Green - 2.1.14-0.cp1146Tom Green - 2.1.11-2.cp1146Jeffrey Royer - 2.1.11-1.cp1146- Added text plugin version 2.0.16- Upstream update to 2.3.7 - Addresses CVE-2024-38999- Add Ubuntu 24 & RedHat 10 support- Add Ubuntu 22 & RedHat 9 support- Add Ubuntu support- Add CentOS 8 support- Added the transformUrl patches- Upstream update to 2.1.14- Added the text plugin- First public release2.3.7.1-1.cp130~el8require.js/usr/local/cpanel/3rdparty/share/requirejs/source/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuASCII textutf-863ae2219a38ea8c6f30a349b561375c6bc56db1a963cfd9633473c2181739d17?]ȸgNcQ41kQced40521ae2ea9794ad5820e9b4c72cbe442f19b227483ce2bdcde61fcdb793b68b2aa4236294bfdc6da1a8e78d27abbbc2d503fj{T8j{Ularchtocentry.htmlarchtocnombox.htmlarticle.htmlbounce.txtcheckdbs.txtconvert.txtcronpass.txtdisabled.txtemptyarchive.htmlheadfoot.htmlhelp.txtinvite.txtlistinfo.htmlmasthead.txtnewlist.txtnomoretoday.txtoptions.htmlpostack.txtpostauth.txtpostheld.txtprivate.htmlprobe.txtrefuse.txtroster.htmlsubauth.txtsubscribe.htmlsubscribeack.txtunsub.txtunsubauth.txtuserpass.txtverify.txtkoadmindbdetails.htmladmindbpreamble.htmladmindbsummary.htmladminsubscribeack.txtadminunsubscribeack.txtadmlogin.htmlapprove.txtarticle.htmlbounce.txtcheckdbs.txtconvert.txtcronpass.txtdisabled.txtemptyarchive.htmlheadfoot.htmlhelp.txtinvite.txtlistinfo.htmlmasthead.txtnewlist.txtoptions.htmlpostack.txtpostauth.txtpostheld.txtprixXL9$Z999ated for each package (#26342)- gettextize init scripts- add some comments to the ksu patches for the curious - re-enable optimization on alphas- fix krb5-send-pr (#18932) and move it from -server to -workstation - buildprereq libtermcap-devel - temporariliy disable optimization on alphas - gettextize init scripts- force -fPIC- rebuild in new environment- add bison as a BuildPrereq (#20091)- change /usr/dict/words to /usr/share/dict/words in default kdc.conf (#20000)- apply kpasswd bug fixes from David Wragg- make krb5-libs obsolete the old krb5-configs package (#18351) - don't quit from the kpropd init script if there's no principal database so that you can propagate the first time without running kpropd manually - don't complain if /etc/ld.so.conf doesn't exist in the -libs %post- fix credential forwarding problem in klogind (goof in KRB5CCNAME handling) (#11588) - fix heap corruption bug in FTP client (#14301)- fix summaries and descriptions - switched the default transfer protocol from PORT to PASV as proposed on bugzilla (#16134), and to match the regular ftp package's behavior- rebuild to compress man pages.- move initscript back- disable servers by default to keep linuxconf from thinking they need to be started when they don't- automatic rebuild- change cleanup code in post to not tickle chkconfig - add grep as a Prereq: for -libs- move condrestarts to postun - make xinetd configs noreplace - add descriptions to xinetd configs - add /etc/init.d as a prereq for the -server package - patch to properly truncate $TERM in krlogind- update to 1.2.1 - back out Tom Yu's patch, which is a big chunk of the 1.2 -> 1.2.1 update - start using the official source tarball instead of its contents- Tom Yu's patch to fix compatibility between 1.2 kadmin and 1.1.1 kadmind - pull out 6.2 options in the spec file (sonames changing in 1.2 means it's not compatible with other stuff in 6.2, so no need)- tweak graceful start/stop logic in post and preun- update to the 1.2 release - ditch a lot of our patches which went upstream - enable use of DNS to look up things at build-time - disable use of DNS to look up things at run-time in default krb5.conf - change ownership of the convert-config-files script to root.root - compress PS docs - fix some typos in the kinit man page - run condrestart in server post, and shut down in preun- only remove old krb5server init script links if the init script is there- disable kshell and eklogin by default- patch mkdir/rmdir problem in ftpcmd.y - add condrestart option to init script - split the server init script into three pieces and add one for kpropd- make sure workstation servers are all disabled by default - clean up krb5server init script- apply second set of buffer overflow fixes from Tom Yu - fix from Dirk Husung for a bug in buffer cleanups in the test suite - work around possibly broken rev binary in running test suite - move default realm configs from /var/kerberos to %{_var}/kerberos- make ksu and v4rcp owned by root- use %{_infodir} to better comply with FHS - move .so files to -devel subpackage - tweak xinetd config files (bugs #11833, #11835, #11836, #11840) - fix package descriptions again- change a LINE_MAX to 1024, fix from Ken Raeburn - add fix for login vulnerability in case anyone rebuilds without krb4 compat - add tweaks for byte-swapping macros in krb.h, also from Ken - add xinetd config files - make rsh and rlogin quieter - build with debug to fix credential forwarding - add rsh as a build-time req because the configure scripts look for it to determine paths- fix config_subpackage logic- remove setuid bit on v4rcp and ksu in case the checks previously added don't close all of the problems in ksu - apply patches from Jeffrey Schiller to fix overruns Chris Evans found - reintroduce configs subpackage for use in the errata - add PreReq: sh-utils- fix double-free in the kdc (patch merged into MIT tree) - include convert-config-files script as a documentation file- patch ksu man page because the -C option never worxXXL`$0edhat.com> 1.23.10-1Dan Walsh 1.23.9-1Dan Walsh 1.23.8-1Dan Walsh 1.23.7-1Dan Walsh 1.23.6-1Dan Walsh 1.23.5-1Dan Walsh 1.23.4-3Dan Walsh 1.23.4-1Dan Walsh 1.23.3-2Dan Walsh 1.23.3-1Dan Walsh 1.23.2-1Dan Walsh 1.23.1-1Dan Walsh 1.22-2Dan Walsh 1.21.22-2Dan Walsh 1.21.22-1Dan Walsh 1.21.21-1Dan Walsh 1.21.20-3Dan Walsh 1.21.20-2Dan Walsh 1.21.20-1Dan Walsh 1.21.19-4Dan Walsh 1.21.19-2Dan Walsh 1.21.19-1Dan Walsh 1.21.18-2Dan Walsh 1.21.18-1Dan Walsh 1.21.17-2Dan Walsh 1.21.17-1Dan Walsh 1.21.15-9Dan Walsh 1.21.15-8Dan Walsh 1.21.15-5Dan Walsh 1.21.15-1Dan Walsh 1.21.14-1Dan Walsh 1.21.13-1Dan Walsh 1.21.12-2Dan Walsh 1.21.12-1Dan Walsh 1.21.10-2Dan Walsh 1.21.10-1Dan Walsh 1.21.9-1Dan Walsh 1.21.7-3Dan Walsh 1.21.5-1Dan Walsh 1.21.4-1Dan Walsh 1.21.3-2Dan Walsh 1.21.3-1Dan Walsh 1.21.1-3Dan Walsh 1.21.1-1Dan Walsh 1.20.1-2Dan Walsh 1.20.1-1Dan Walsh 1.19.3-1Dan Walsh 1.19.2-4Dan Walsh 1.19.2-1Dan Walsh 1.19.1-1Dan Walsh 1.18.1-3Dan Walsh 1.18.1-1Steve Grubb 1.17.7-3Dan Walsh 1.17.7-2Dan Walsh 1.17.7-1Dan Walsh 1.17.6-2Dan Walsh 1.17.6-1Dan Walsh 1.17.5-6Dan Walsh 1.17.5-5Dan Walsh 1.17.5-4Dan Walsh 1.17.5-3Dan Walsh 1.17.5-2Dan Walsh 1.17.5-1Dan Walsh 1.17.4-1Dan Walsh 1.17.3-4Dan Walsh 1.17.3-3Dan Walsh 1.17.3-2Dan Walsh 1.17.3-1Dan Walsh 1.17.2-1Dan Walsh 1.17.1-1Dan Walsh 1.15.7-1Dan Walsh 1.15.6-1Dan Walsh 1.15.5-1Dan Walsh 1.15.3-2Dan Walsh 1.15.3-1Dan Walsh 1.15.2-4Dan Walsh 1.15.2-3Dan Walsh 1.15.2-2Dan Walsh 1.15.2-1Dan Walsh 1.15.1-2Dan Walsh 1.15.1-1Dan Walsh 1.14.1-2Dan Walsh 1.14.1-1Dan Walsh 1.13.4-1Dan Walsh 1.13.3-2Dan Walsh 1.13.3-1Dan Walsh 1.13.2-2Dan Walsh 1.13.2-1Elliot Lee Dan Walsh 1.13.1-2Dan Walsh 1.13.1-1Dan Walsh 1.13-3Dan Walsh 1.13-2Dan Walsh 1.13-1Dan Walsh 1.12-2Dan Walsh 1.12-1Dan Walsh 1.11-4Dan Walsh 1.11-3Dan Walsh 1.11-2Dan Walsh 1.11-1Dan Walsh 1.10-4Colin Walters 1.10-3Dan Walsh 1.10-2Dan Walsh 1.10-1Dan Walsh 1.9.2-1xКXL$2192268612916f87eb21d3e7a667c17a4334815c3dbab97a2088cc1c58884f810c731a51502978ac32185ddcc3f0507dd24fdfd11e4c08be254172647149a15f7ef24c0cf791bdd69da6f053c0c37974577be6dc8ddafd801e4ed70b38f2b98410ff04e1173858a82d2fed618e60bec7577b27841bd3d552b66ef84a199214b1d9fa7e8e9b396cc0121e7e999e86b606b9d8a8d274b62f0fc4b5cd49a1e5f42fb7f173665863677d789051563b84259bc59fed035a74ba5b36f5e15f9a9fa0f5415baa069e7dc45ca5addad309a9fc396cd826b576a0fdbdc1d4155df5b1a3763d8cbbc7b973ff9335fe694d092af600286de1e83d5577798192ddde299944bc60ec70765776496962c1e041bf16c54f4b63776e53bb45bfc43098755fa3bfaca77fa4f5393cf531cdd22c48e3bedf3eab14096e2e5979cae1683b891ddc774a9fab55e65fe520ca2ddf8d444815678ccd5163abcacd3f69cedb14b24192c39297ddb3e4c6dc0f8eff7013ae655e9a724df257ff22cfbdf75a409c916b3cf2cbdac793a864220d6b17d1703836f15e1374b845621d2ee231ebb295c5a7c04a475c6fe33e9b516dcd5474f98b3aacc52ebdfb93c3d06fde01c18fcaudit2allowrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpolicycoreutils-2.9-26.el8_10.src.rpmpolicycoreutils-python-utils@    /usr/libexec/platform-pythonpython3-policycoreutilsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)2.9-26.el8_103.0.4-14.6.0-14.0-15.2-14.14.3eZe@c@cccR@bb8aea@aC1`i@`Gc@`3`>`U`@^!]|@]@]ʞ]µ]o@]^]G@\@\@\\l@\[[%@[Ѱ@[[ā@[[Q@[W[P}@[2*[[[@ZlZZZ@ZZ Z@Zv@Z}@ZqZ`@Z:PZ1@ZfY@Y(@Y(@YV@Y@Y}@Y{'@YyX-XXf@XX@XBXXZnX@X43@WH@W9W@WgW@W~Wq@Wk@W3W'A@W#LWW@VV@V@VIV=@Vn@VKVI@VD@V@V9@VZVqUUUŬUL@U@U@U(U(U@U4@U4@UK@Uy@UUJ@U+TgTfTk4TZ@TZ@T!`S@SuS/SϣSSS{CSuSpShShS`SZN@SXS:@S4S2@S0@R@R@RRa@RR=RʚRƦ@RƦ@R1@R@R@RR@RRG@R@R RrF@RrF@Rj]@R^RW@RW@RNRL RIgRFR9R' R' R%@R @RC@R R6R6R@Q@QdQQp@Q*@Q@Q5Q@QLQLQֵ@Q4Q@Q@@Q@@Q@QKQKQ@Q@QyQyQ(@QQQ@QaQ@Q'@Q'@QQQ@Q@Qu&@QfQeT@QdQb@Q\QYvQT0QR@QR@QP<@QJ@QJ@QHS@QAQ=@Q8@Q7/Q5@Q4Q0@Q/FQ/FQ*Q*Q']Q']Q']Q& @Q& @Q$Q"QQQ@Q.Q@Q \QsPDPDP[P[PP@PrPPѬ@P @P @PPPP7@PPPN@PN@PP@P@P*P6@P6@P6@PPPM@P@P@P@Pd@P@PoPoPP{@P)P)P5@P@P~P~P}L@P}L@Puc@PtPr@Pp@Pmz@PaPU@PU@PQP"TPPOjOO0@O"O"OO9O Os@O@O~O8OOD@O@Oz@Oz@Ou@OtNOr@OiOX@OX@ON@OKp@OB5OM@M@MM2@MMMI@M@M@MzMzMwkMv@Mv@MtMoMgMRMJMJMIG@M9u@M6@M0:M%M$]@M@MM @MLLL[@L[@L@LΫLΫLʷ@Lq@L*@LA@LA@L@L@LL@L)@L{@L{@LuLs@LrbLe3Le3Lc@LZLZLZLZLYV@LT@LPLPLN@LMxLF@LELk@Lk@Lk@L0L @L@L@LGLGK^KuKuKuKKKFK @K޺KtK#@KKKKŮ@K\K"@K9@KK@xHXfL ? v$fvuwdded new command ``dnf alias [options] [list|add|delete] [...]`` to allow the user to define and manage a list of aliases - Enhanced documentation - Unifying return codes for remove operations - [transaction] Make transaction content available for commands - Add hotfix packages to install pool (RhBug:1654738) - Report group operation in transaction table - [sack] Change algorithm to calculate rpmdb_version - Add basic integration with digest (RhBug:1614351)- Added dnf.repo.Repo.get_http_headers - Added dnf.repo.Repo.set_http_headers - Added dnf.repo.Repo.add_metadata_type_to_download - Added dnf.repo.Repo.get_metadata_path - Added dnf.repo.Repo.get_metadata_content - Added --changelogs option for check-update command - [module] Add information about active modules - Hide messages created only for logging - Enhanced --setopt option - [module] Fix dnf remove @ - [transaction] Make transaction content available for plugins- Backport patches for setting cachedir with --setopt- Update to 4.0.4 - Add dnssec extension - Set termforce to AUTO to automatically detect if stdout is terminal - Repoquery command accepts --changelogs option (RhBug:1483458) - Calculate sack version from all installed packages (RhBug:1624291) - [module] Allow to enable module dependencies (RhBug:1622566)- [module] Improved module commands list, info - [module] Reports error from module solver - Fix: Error detected when calling 'RepoCB.fastestMirror' (RhBug:1628056) - Preserve packages from other installed mod profiles (RhBug:1629841) - [spec] Postpone conflict with yum to Fedora 30+ (RhBug:1600444) - [cli] Install command recommends alternative packages (RhBug:1625586) - [cli] Fix case insensitive hint (1628514) - Fix installed profiles for module info (RhBug:1629689) - Fix module provides not having consistent output (RhBug:1623866) - Enhance label for transaction table (RhBug:1609919) - Implement C_, the gettext function with a context (RhBug:1305340) - Actually disambiguate some messages using C_ (RhBug:1305340) - Restore 'strict' choice for group installs (#1461539) - [repoquery] More strict queryformat parsing (RhBug:1631458) - Redirect repo progress to std error (RhBug:1626011) - Unify behavior of remove and module remove (RhBug:1629848) - Change behavior of disabled module for module install (RhBug:1629711) - Allow enablement on disabled plugin (RhBug:1614539) - Resolves: rhbz#1622585 - [modularity] dnf should not be proposing distro-sync - Resolves: rhbz#1614531 - dnf 3.2 does not depsolve correctly - Bug 1564369 - don't show duplicate errors in dnf output - Resolves: rhbz#1597257 - dnf should accept localinstall command, at least as an alias - Resolves: rhbz#1613860 - dnf search behaviour is slightly confusing - Resolves: rhbz#1625586 - Advise user about alternatives to the non-existing "python" package - Resolves: rhbz#1614346 - dnf rollback doesn't work after install/downgrade/upgrade - Resolves: rhbz#1612752 - platform-python should be used in completion_helper - Resolves: rhbz#1618421 - dnf module install fails to find non-modular dependencies - Bug 1629655 - not helpful/complete error message when specifying wrong stream or profile - Bug 1629709 - disabled modules should be identified in the module listing - Bug 1630761 - [usability] unable to determine if a stream with [d] is enabled or not - Bug 1625270 - there is ???% [=== when baseurl is wrong - Resolves: rhbz#1624056 - quoted baseurl is error out- [module] Fixed list and info subcommands (RhBug:1623388) (RhBug:1623535)- New implementation of modularity - dnf makecache should not fail in red color if no enabled repos (RhBug:1622090) - [modularity] dnf module profile command doesn't work (RhBug:1622580) - [modularity] incorrect output in dnf module list (RhBug:1623398) - [modularity] dnf could be smarter when installing what's already installed (RhBug:1622599) - [modularity] dnf module install circular error on missing dependency (RhBug:1620233) - not descriptive output in dnf verbose (RhBug:1612718) - RFE: provide way to query all packagexyXL9$P999credentials obtained via S4U2Proxy with the principal name of the proxying principal (part of #761317) so that the default principal name can be set to that of the client for which it is proxying, which results in the ccache looking more normal to consumers of the ccache that don't care that there's proxying going on - pull in patch for RT#7047: allow tickets obtained via S4U2Proxy to be cached (more of #761317) - pull in patch for RT#7048: allow PAC verification to only bother trying to verify the signature with keys that it's given (still more of #761317)- apply upstream patch to fix a null pointer dereference when processing TGS requests (CVE-2011-1530, #753748)- correct a bug in the fix for #754001 so that the file creation context is consistently reset- update to 1.10 alpha 1 - on newer releases where we can assume NSS >= 3.13, configure PKINIT to build using NSS - on newer releases where we build PKINIT using NSS, configure libk5crypto to build using NSS - rename krb5-pkinit-openssl to krb5-pkinit on newer releases where we're expecting to build PKINIT using NSS instead - during %check, run check in the library and kdc subdirectories, which should be able to run inside of the build system without issue- Rebuilt for glibc bug#747377- apply upstream patch to fix a null pointer dereference with the LDAP kdb backend (CVE-2011-1527, #744125), an assertion failure with multiple kdb backends (CVE-2011-1528), and a null pointer dereference with multiple kdb backends (CVE-2011-1529) (#737711)- pull in patch from trunk to rename krb5int_pac_sign() to krb5_pac_sign() and make it public (#745533)- kadmin.service: fix #723723 again - kadmin.service,krb5kdc.service: remove optional use of $KRB5REALM in command lines, because systemd parsing doesn't handle alternate value shell variable syntax - kprop.service: add missing Type=forking so that systemd doesn't assume simple - kprop.service: expect the ACL configuration to be there, not absent - handle a harder-to-trigger assertion failure that starts cropping up when we exit the transmit loop on time (#739853)- hardcode pid file as option in krb5kdc.service- fix pid path in krb5kdc.service- convert to systemd- pull in upstream patch for RT#6952, confusion following referrals for cross-realm auth (#734341) - pull in build-time deps for the tests- switch to the upstream patch for #727829- handle an assertion failure that starts cropping up when the patch for using poll (#701446) meets servers that aren't running KDCs or against which the connection fails for other reasons (#727829, #734172)- override the default build rules to not delete temporary y.tab.c files, so that they can be packaged, allowing debuginfo files which point to them do so usefully (#729044)- build shared libraries with partial RELRO support (#723995) - filter out potentially multiple instances of -Wl,-z,relro from krb5-config output, now that it's in the buildroot's default LDFLAGS - pull in a patch to fix losing track of the replay cache FD, from SVN by way of Kevin Coffman- kadmind.init: drop the attempt to detect no-database-present errors (#723723), which is too fragile in cases where the database has been manually moved or is accessed through another kdb plugin- backport fixes to teach libkrb5 to use descriptors higher than FD_SETSIZE to talk to a KDC by using poll() if it's detected at compile-time (#701446, RT#6905)- pull a fix from SVN to try to avoid triggering a PTR lookup in getaddrinfo() during krb5_sname_to_principal(), and to let getaddrinfo() decide whether or not to ask for an IPv6 address based on the set of configured interfaces (#717378, RT#6922) - pull a fix from SVN to use AI_ADDRCONFIG more often (RT#6923)- apply upstream patch by way of Burt Holzman to fall back to a non-referral method in cases where we might be derailed by a KDC that rejects the canonicalize option (for example, those from the RHEL 2.1 or 3 era) (#715074)- pull a fix from SVN to get libgssrpc clients (e.g. kax8iXLPP}$>y=True * semanage: set modified correctly * restorecond: make restorecond dbuss-able * restorecon: Always check return code on asprintf * restorecond: make restorecond -u exit when terminal closes * sandbox: introduce package name and language stuff * semodule_package: remove semodule_unpackage on clean * fix sandbox Makefile to support DESTDIR * semanage: Add -o description to the semanage man page * make use of the new realpath_not_final function * setfiles: close /proc/mounts file when finished * semodule: Document semodule -p in man page * setfiles: fix use before initialized * restorecond: Add .local/share as a directory to watch - Upgrade to sepolgen upstream * Ignore permissive qualifier if found in an interface * Return name field in avc data- Rebuild versus newer libsepol- A couple of minor coverity fixes for a potential leaked file descriptor - An an unchecked return code. - Add ~/.local/share/* to restorecond_user watches- Have sepolgen return name field in AVC- restorecond -u needs to watch terminal for exit if run outside of dbus.- Do not drop capabilities if running newrole as root-Update to upstream * semanage: fix indentation error in seobject- Ignore permissive commands in interfaces- Remove gnome requirement from polgengui-Update to upstream policycoreutils-2.1.6 * sepolgen-ifgen: new attr-helper does something * audit2allow: use alternate policy file * audit2allow: sepolgen-ifgen use the attr helper * setfiles: switch from stat to stat64 * setfiles: Fix potential crash using dereferenced ftsent * setfiles: do not wrap * output at 80 characters * sandbox: add -Wall and -Werror to makefile * sandbox: add sandbox cgroup support * sandbox: rewrite /tmp handling * sandbox: do not bind mount so much * sandbox: add level based kill option * sandbox: cntrl-c should kill entire process control group * Create a new preserve_tunables flag in sepol_handle_t. * semanage: show running and disk setting for booleans * semanage: Dont print heading if no items selected * sepolgen: audit2allow is mistakakenly not allowing valid module names * semanage: Catch RuntimeErrors, that can be generated when SELinux is disabled * More files to ignore * tree: default make target to all not install * sandbox: do not load unused generic init functions sepolgen-1.1.2 * src: sepolgen: add attribute storing infrastructure * Change perm-map and add open to try to get better results on * look for booleans that might solve problems * sepolgen: audit2allow is mistakakenly not allowing valid module names * tree: default make target to all not install- Change separator on -L from ; to :- Add back lockdown wizard for booleans using pywebkitgtk- Maintain the LANG environment Variable into the sandbox - Change restorecon/setfiles to only change type part of the context unless -f qualifier is given- Remove lockdown wizard, since gtkhtml2 is no longer supported.- Allow setfiles and restorecon to use labeledprefix to speed up processing and limit memory.-Update to upstream * policycoreutils * setfiles: Fix process_glob to handle error situations * sandbox: Allow seunshare to run as root * sandbox: trap sigterm to make sure sandbox * sandbox: pass DPI from the desktop * sandbox: seunshare: introduce helper spawn_command * sandbox: seunshare: introduce new filesystem helpers * sandbox: add -C option to not drop * sandbox: split seunshare caps dropping * sandbox: use dbus-launch * sandbox: numerous simple updates to sandbox * sandbox: do not require selinux context * sandbox: Makefile: new man pages * sandbox: rename dir to srcdir * sandbox: allow users specify sandxXXL;K$+;KHN cpanel-common-licenses     rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h6b`Gc@]d@SvRW@RUE@RB@Michael Salinas - 1.0.0-1.cp130~el8Nicolas Rochelemagne - 1.0.0-1.cp108Nicolas Rochelemagne - 1.0.0-1.cp1198Nicolas Rochelemagne - 1.0.0-1.cp1186Nicolas Rochelemagne - 1.0.0-4.cp1136Nicolas Rochelemagne - 1.0.0-3.cp1136Nicolas Rochelemagne - 1.0.0-2.cp1136Nicolas Rochelemagne - 1.0.0-1.cp1136- Add AlmaLinux 10 & Ubuntu 24 support.- Add RedHat 9 & Ubuntu 22 support.- rebuild with Ubuntu support- rebuild with CentOS 8 support- fix the build / install logic- do not replace macro in licenses- add PHP License- init rpm 1.0.0-1.cp130~el8Apache-2.0ArtisticBSDBSD-2BSD-3CCCC-3.0Catharon-OSLFTLGFDLGFDL-1.2GFDL-1.3GPLGPL-1GPL-2GPL-3GZipLGPLLGPL-2LGPL-2.1LGPL-3MITMPLMPL-1.0MPL-1.1MPL-2PHPPHP-3.0.1Zlib/usr/local/cpanel/3rdparty/share/common-licenses/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuASCII textASCII text, with very long linesutf-8f2df3a00252af7d96548b83c16dfcae3e70cf64294f026b0167ef54c697df093?hhm}*x8405c6e1d592e696dabb8b4ad13237bbb98ebe50ad9c6af174f25f8e7b2409333997a337a73b49fa6c4b77113410ce539980dff5j{Hj{U/cpanel/3rdparty/perl/536/cpanel-lib/Plack/Middleware/Auth/OIDC/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuASCII textPerl5 module source textutf-84f741717cfb91956d8540872392faa27d30b726f85265a9a5e6a9d427fe5497c?GcJM~ҍ4psod64265c65567028760f999dd2c3a332982fb88b472101da4861fc1cc6f7f468210fb172d4e20e2a6c8471e52cde1d4d6391e05f9j{||j{{k. PlainText.pmp, x/ Plain.phpuv Plack.pm3Pixels.hP` `n Pitcairn.pmcr0K#Q)bQrSPitcairnPoPipesInterface.phpto IPipesGBwMwmPipe.pm BMi Pinyin.pm'P PingStore.pme("!B1M10 !_Ping.pmz, n PinEntry.phpP e Pieces.pmVBMaPiece.so-VBMpPiece.pmrx(HXLH 8BcO$scObOFk?jd * f  t8\\ `\ \ \ $\ \\ \""\$($@ $h % (%D8%L9%:*>[@[#B[+G[D\H\\I^$\X^Y^Z^[^\^\]`\^cs bedf_efdffglfitf\ug\vidiiijj$j( j8jajj\kgkhk Ccpanel-php84-net-dns21.5.01.cp130~el8PHP Resolver library used to communicate with a DNS server.Provides (roughly) the same functionality as Net_DNS, but using modern PHP objects, exceptions for error handling, better sockets support. This release is (in most cases) 2x - 10x faster than Net_DNS, as well as includes more RR's (including DNSSEC RR's), and improved sockets and streams support.hC{]bh-centos-8.dev.cpanel.netvBSD LicenseDevelopment/Librarieshttp://pear.php.net/package/Net_DNS2linuxnoarchecho /usr/local/cpanel/3rdparty/php/84/lib/pear/Net_DNS2.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place. if [ x$1 = x0 ]; then echo pear.php.net/Net_DNS2 >> /var/cpanel/.pending_pear_deregistrations ; fi(UM XX& #B  mgk   b Q z " K S * 8 s  :.  ? L! 0 ,B4? ~ 3 ,F&QAA큤A큤A큤A큤AA큤_2;hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{\hC{]hC{\hC{\e71de6b06313fd4a5062331f42eae0e393803a14a1a6132469deb8d3f21130e8fd12a64079b2b87a88b340fe580190c597eb7c2fb7b860c6e1b7a00d3b78c97bbfd91d057675a35b35e37791395182408dcea24e5cabefa3b6c75c1d7763fddc6df81900919584c0964bc3f81a3baa6e3c1c5e4ee8b2cb9c5c80a92713494ba7f96efd811a707694ccd8c29e44890e5ff30d0c4fe43feaf33a8d9e76631713220428bddf7f104511eeb35fc6438a589178de4ed7f149a5792a49d8a29da11a98e1864fd6663d2e8b57979f20e0f12d7c3cb9787e462bbbfdcdf50029f8e028affe63ba34c38f5328952c300c8115306de30d7fc97ed15e878e189c3008a5c2c4a42afb374ca3ba360dfcc4de4d547bd55fa5d31b47fcf3d8f5e335f5d2fd885da422cced4a4deb4f1c768d017f1cad4b15740fc68f35ca647293f0aee2b49af12196bfa5e2caae5a7c457aac6aa851bc191cf798ab6098c171f72896c9972fd0164d96e6057e2d78f8a534d618dc6d2bd2b33b208aafeb647f033daa471702bbc5b33efbaa02e9f0c12942a1c1450b17663c6758390e74bab0078aabee7bd621dbb2e0c423955751fb88631e52fe50c7e55066a652354860f362a20eaebae9f53271fa2018331961004a91b2c999fc055e3e27c34f5b8966ab201a4cb75736f2a2b76faa6f73a010d1358954759bcfa7e4x7XLR9$]99XRRR RR RRRRR RRR RRRRR%RR RR RRRR RRR RRRRR%R R RRRRR RRR RRRRR%RRRRRRRPRR!PRR!RPRRR!PRR!R RPRR!PRR P RR P RRRRR RR RRRRR RRR RRRRR%RR RRRR RRR RRRRR%RR R RRRR RRR RRRRR%utf-8dc76da88c55fb68629b01a1b9db8e8fc70c210076942919a12f9f8b5efb1c90f?@3!^P,*%j *%tN*~Dndd'r?e^X[)'DIz/1+=Bt+=C(觰g k3S5[QdJctqߔgh}CCoe7׶w)ju_A<_J 8J FkF\1졡eX}|B( 73b2@lE o=#aK>->{jW] fqebAX1_܈94+І0ʀاZ9iU  B #^r&Og!n &+t143< zBx ~ Gvv/&G ԢVSGV=<7Q^BЧ"JhPh*;W]!qHi~hg~V€p/` nU!o~9W1,BxG6gIh܍2,69addbdfd4fdc12cc651b0b57719d49120e69d7bf9866ff4c7d451b96887ae7aa937f57a193ae2725b418faf999fb60c009b4bc2j{xij{x c setjmp.3p.gzeZ psetitimer.3p.gznisettings-3-fill.svgg-settings-2-line.svgpassettings-2-fill.svgurZ_settimeofday.2.gzZpsetstate_r.3.gzcyZZ setstate.3.gzZ setspent.3.gzZssetsockopt.2.gz.cZp setsid.2.gzcuZxsetservent.3.gz- psetsebool.8.gzbui-/1 setsebool- sets.pyoi, -sets.pyc 82+. Qq9 sets.pyrtZ setrpcent.3.gzWMMM lsetroubleshoot3 bLl setrlimit.al5Z2setrlimit.2.gzcotZtsetreuid32.2.gzloZ setreuid.2.gzZsetresuid32.2.gzcZtsetresuid.2.gzck.Zsetresgid32.2.gzZssetresgid.2.gz-Z setregid32.2.gzpZl setregid.2.gzM*n setrans.confrM MI |ysetransleZs setpwent.3.gzZssetprotoent.3.gzoLdsetpriority.alt sZusetpriority.2.gzZ setpgrp.2.gz.Z setpgid.2.gzsZf setns.2.gz-ZWsetnetgrent.3.gzsZMsetnetent.3.gzs.lZMsetmntent.3.gzsZsetlogmask.3.gznsKy setlocale.ctiZsetlocale.3.gztroZbsetlinebuf.3.gzyZe setkey_r.3.gzZa setkey.3.gzMZ/xsetjmp.h.0p.gz - Zs setjmp.3.gzLZ1setitimer.2.gz,Zisethostname.2.gzsZssethostid.3.gzZsethostid.2.gzus.Z vsethostent.3p.gznZrsethostent.3.gzZ-setgroups32.2.gz<Z~isetgroups.2.gzvZ Usetgrent.3p.gz2.gZa setgrent.3.gzZ}c setgid32.2.gzx'X/L8hN$QN ? $?d(3 ? t  (, . 0 4 u x|@ t  (89:GHI XY\L]P^Xbdeflt uv04:|    g h Ccpanel-perl-542-net-dns-resolver-mock1.202302161.cp130~el8CPAN module - Mock a DNS Resolver object for testingCpanel build perl module 'Net::DNS::Resolver::Mock'Mock a DNS Resolver object for testingh+bh-centos-8.dev.cpanel.netnperlcpanel/perlhttps://metacpan.orglinuxnoarchn$c8916909a05cbaffaef7abc830357bfd4e5ab41b4cd03b2b0ceb349d73bc95cd6rootrootcpanel-perl-542-net-dns-resolver-mock-1.20230216-1.cp130~el8.src.rpmcpanel-perl(Net::DNS::Resolver::Mock)cpanel-perl-542-net-dns-resolver-mockcpanel-perl-net-dns-resolver-mock     cpanel-perl-542cpanel-perl-542-basecpanel-perl-542-net-dns-packetcpanel-perl-542-net-dns-questioncpanel-perl-542-net-dns-resolvercpanel-perl-542-net-dns-zonefilecpanel-perl-542-strictcpanel-perl-542-warningsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h@b@`-@_9[-Todd Rinaldo - 1.20230216-1.cp130Busy Camels - 1.20200215-1.cp108Busy Camels - 1.20200215-1.cp1198Todd Rinaldo - 1.20200215-1.cp1194Todd Rinaldo - 1.20171219-1.cp1178- Update from upstream: Net-DNS-Resolver-Mock 1.20230216- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Net-DNS-Resolver-Mock 1.20200215- Update from upstream: Net-DNS-Resolver-Mock 1.201712191.202302161.20230216-1.cp130~el81.20230216Mock.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Net/DNS/Resolver/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-829ffbec05348259526e20b4bb60f50b5242b70a2e3a5f827b8e5a5a4d3394499?aDd_^Okca6d8bb192fa1f5b506f25c963169b3108618a5c6b2ab51cf84c8f91909f5c3d8d9895f1195de85c2e4dd55f2c93ff1ed66e7b54j{j{U2cpanel-ng-whm-WhmMarketplacecpanel-ng-whm-whmMarketplace 116.16.14-1.cp111163rdpartylicenses.txtassetsproduct-logoscloudlinux.pngcpanelwhm.pngimunify360.pngimunifyavplus.pngjetbackup.svgkernelcare.pnglitespeed.pngwhmcs.pngvariables.scssfavicon.icoindex.html.ttmain.jspolyfills.jsruntime.jsscripts.jsstyles.cssvendor.jswebpack.shim.html/usr/local/cpanel/whostmgr/docroot/templates/whm-marketplace/xXL8d9$-999 dictate particular exit codes before exec'ing the actual binaries, instead of trying to use ConditionPathExists in the unit files to accomplish that, so that we exit with failure properly when what we expect isn't actually in effect on the system (#800343)- attempt to account for UnversionedDocdirs for the -libs subpackage- tweak configuration files used during tests to try to reduce the number of conflicts encountered when builds for multiple arches land on the same builder- pull up changes to allow GSSAPI modules to provide more functions (RT#7682, #986564/#986565)- use (a bundled, for now, copy of) nss_wrapper to let us run some of the self-tests at build-time in more places than we could previously (#978756) - cover inconsistencies in whether or not there's a local caching nameserver that's willing to answer when the build environment doesn't have a resolver configuration, so that nss_wrapper's faking of the local hostname can be complete- specify dependencies on the same arch of krb5-libs by using the %{?_isa} suffix, to avoid dragging 32-bit libraries onto 64-bit systems (#980155)- special-case /run/user/0, attempting to create it when resolving a directory cache below it fails due to ENOENT and we find that it doesn't already exist, either, before attempting to create the directory cache (maybe helping, maybe just making things more confusing for #961235)- update to 1.11.3 - drop patch for RT#7605, fixed in this release - drop patch for CVE-2002-2443, fixed in this release - drop patch for RT#7369, fixed in this release - pull upstream fix for breaking t_skew.py by adding the patch for #961221- respin with updated version of patch for RT#7650 (#969331)- don't forget to set the SELinux label when creating the directory for a DIR: ccache - pull in proposed fix for attempts to get initial creds, which end up following referrals, incorrectly trying to always use master KDCs if they talked to a master at any point (should fix RT#7650)- pull in patches from master to not test GSSRPC-over-UDP and to not depend on the portmapper, which are areas where our build systems often give us trouble, too- backport fix for not being able to verify the list of transited realms in GSS acceptors (RT#7639, #959685) - backport fix for not being able to pass an empty password to the get-init-creds APIs and have them actually use it (RT#7642, #960001) - add backported proposed fix to use the unauthenticated server time as the basis for computing the requested credential expiration times, rather than the client's idea of the current time, which could be significantly incorrect (#961221)- pull in upstream fix to start treating a KRB5CCNAME value that begins with DIR:: the same as it would a DIR: value with just one ccache file in it (RT#7172, #965574)- pull up fix for UDP ping-pong flaw in kpasswd service (CVE-2002-2443,- Update otp patches - Merge otp patches into a single patch - Add keycheck patch- pull the changing of the compiled-in default ccache location to DIR:/run/user/%{uid}/krb5cc back into F19, in line with SSSD and the most recent pam_krb5 build- correct some configuration file paths which the KDC_DIR patch missed- update to 1.11.2 - drop pulled in patch for RT#7586, included in this release - drop pulled in patch for RT#7592, included in this release - pull in fix for keeping track of the message type when parsing FAST requests in the KDC (RT#7605, #951843) (also #951965)- move the compiled-in default ccache location from the previous default of FILE:/tmp/krb5cc_%{uid} to DIR:/run/user/%{uid}/krb5cc (part of #949588)- Update otp backport patches (libk5radius => libkrad)- when testing the RPC library, treat denials from the local portmapper the same as a portmapper-not-running situation, to allow other library tests to be run while building the package- create and own /var/kerberos/krb5/user instead of /var/kerberos/kdc/user, since that's what the libraries actually look for - add buildrequires on nss-myhoxX L 5$s5l ? t?d)/ ; i    " $ ( i lpuz0P(A8H9h:GdHhIlXpY|\]^bd:e?fBlDt\u`vd   ` d hg lh pCcpanel-perl-542-module-extract-version1.1191.cp130~el8CPAN module - Extract a module version safelyCpanel build perl module 'Module::Extract::VERSION'Extract a module version safelyhݣbh-centos-8.dev.cpanel.net artistic_2cpanel/perlhttps://metacpan.orglinuxnoarch $gV008a7779107342d05179b0a4e5a510c1cff7fc15f00d0f49f75807a44431c8d9rootrootcpanel-perl-542-module-extract-version-1.119-1.cp130~el8.src.rpmcpanel-perl(Module::Extract::VERSION)cpanel-perl-542-module-extract-versioncpanel-perl-module-extract-version     cpanel-perl-542cpanel-perl-542-tie-hash-namedcapturecpanel-perl-542-versionrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h@bb@`-@X~@X@X@Q+R@Todd Rinaldo - 1.119-1.cp130Todd Rinaldo - 1.115-1.cp108Busy Camels - 1.113-1.cp108Busy Camels - 1.113-1.cp1198Todd Rinaldo - 1.113-1.cp1162Todd Rinaldo - 1.111-1.cp1162Todd Rinaldo - 1.113-1.cp1162Todd Rinaldo - 1.01-1.cp1136- Update from upstream: Module-Extract-VERSION 1.119- Update from upstream: Module-Extract-VERSION 1.115- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Module-Extract-VERSION 1.113- Update from upstream: Module-Extract-VERSION 1.111- Update from upstream: Module-Extract-VERSION 1.113- Update from upstream: Module-Extract-VERSION 1.011.1191.119-1.cp130~el81.119VERSION.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Module/Extract/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8182e2019ba8d1b150f8f85038c24345a51fd578f7b095d4dcb2e381e4095ff81?TQq 96878e8b5f055447f65d4d337063d01ad035a2da244d2cce9d6ef6a3bcd85a6a04e12aa9ad4a263a1fb4338a834c8adcfc5b8a00j{0j{U0e4902eb561ef1135ec5e9dfb6206e25d49509e0bc9bb42f53c48326a514dc3a4cfea764a5b66c77e31d594125cba2526050696e65592f848b95afd5d0b1fa737f5008df49c8db00470bace694613da9065e6d3612a2d26eeda2a33a5ad82e3e24b552dedc59b51aa8ad283626c78925bab1790ed21f1f0e2e620ffc3c155b56a4893f1bcc47a2111107c1a719847e723baed663537ac79845e939704749ed784bdbd2499ffc31ad7db3122b5be72ab584d95dfc49bce4823630fa84a86167ba4122ce4f4e85b13841570aacff355e8cb285c6584081244b8b1d70c574a7b5add58dab060dba92fed2e7594a5873625cae76365e92ad9a64fdb251e2765a12a3a09056de49198b1e9252193ac0a8edc4e0d3b795fb7111adca722993d83179250d83772c430f756dd95222761ac83d34b5bb1828b0882f97xP XLv ;$;3f1fd852597e60ff37af09e473608f3b8fcc3d45f2253461af50bfc01763903361d94f845a47cd370465431e17eff07bd9941072f046ec7708bf246827b27885cf6fd6809d778ccf9682caaee95f58c6c5f9da4cfa612574a0fc262c493b133261d94f845a47cd370465431e17eff07bd9941072f046ec7708bf246827b27885b74a8ace0283a3159a8dad349e4bd9daa6e374745801b6bdf58e2731b73ff6f4b74a8ace0283a3159a8dad349e4bd9daa6e374745801b6bdf58e2731b73ff6f4b74a8ace0283a3159a8dad349e4bd9daa6e374745801b6bdf58e2731b73ff6f414ee70a2c1e45e7134bf9fcd270ff5f3e6e9566998e53d71203007981f321ba7942276f5fbd0d43cec4a674e9e1b2bbe7e2c8e477913c972ea6e95825183e11414ee70a2c1e45e7134bf9fcd270ff5f3e6e9566998e53d71203007981f321ba76921e265e940b46a3ea5609fe0032d8c20369c81dea2884d05c038d2b3a832f2d7b6982f56f7c63534e3bcb094f07ae23e50678515e3b7ecb84b99c1355563df6921e265e940b46a3ea5609fe0032d8c20369c81dea2884d05c038d2b3a832f285d145a9c70a3741ef04586a284e11050f1c08269b488d95a8dee217d36fe32be63c779b8c0ccac413170dde5b7b13535296035264f36f3b5b6bf85de648ad9285d145a9c70a3741ef04586a284e11050f1c08269b488d95a8dee217d36fe32b82a387deabcbd94d882724ca5741f60455a5a2293ad705276d76d311c6adff93210a57446130439be2414f3e6b14f6e5dc8de7044962216cd2dac1c6434f5cc482a387deabcbd94d882724ca5741f60455a5a2293ad705276d76d311c6adff93f7d5b127bc0cddd5e49d6318ffff56663217fbf74b943c5831437b4ed23584dbc3272b78fa233fddc351fab6d82f62d3ed0e2ccc8cfcc268c68211a4f968d511f7d5b127bc0cddd5e49d6318ffff56663217fbf74b943c5831437b4ed23584db386c1b1bbf77878262ebda5df63f89278b091312be43a23058151dd28997ded6e3df5d57963aa151d5bfa24af748211432fa27f25a4d616998001e73866efa67386c1b1bbf77878262ebda5df63f89278b091312be43a23058151dd28997ded6a9c59c7ffb7fdc92c3c8dabb37c4835a6b4fec3a81e99ac6263158c786117497b55942361cebe44fe546121a609f91d48784686615dec22bd85207f08cdaa27aa9c59c7ffb7fdc92c3c8dabb37c4835a6b4fec3a81e99ac6263158c786117497815d182e5e73a621e21900b804bad20e1abfa0f648da1b0eb33baf36f31a7efc6e4d9ab0e80193a4ac420549de7dc84dbafb40ab1900e9839a5dbfb36abe3579815d182e5e73a621e21900b804bad20e1abfa0f648da1b0eb33baf36f31a7efc216a64617023b5873d48f1be763fee1ec02cc32a6319a2910e0cdc6419a98577ef3ef2ca0fa4b22d535a3a5bd78b7921fbc82518b267da50647143daee83f946216a64617023b5873d48f1be763fee1ec02cc32a6319a2910e0cdc6419a98577fc5d5067f68174f3d24e69f7d5b772b2cab78cf2506505ff59eb5a5b0dbcc9c1461f870e305fdb98c8726f699a179f31a5a84fb41161d47e7fd6b6df10a897f7fc5d5067f68174f3d24e69f7d5b772b2cab78cf2506505ff59eb5a5b0dbcc9c1ddafd86387def373bcfcd5ed24fe873cdc02c311d2dd4956b0d9b729a153e915d7910760f51dbfc03089bbc8336084b638b604032058a98ca809a5c0c4d08e04ddafd86387def373bcfcd5ed24fe873cdc02c311d2dd4956b0d9b729a153e91561e465451aa8f36461d3d7dd8914a798415f1d84fafc0ebfca3eb8d87b38cc844755cfae0bd6bd985c7088313a913d33c2406ca0276598cf4126bf51c85bdbf561e465451aa8f36461d3d7dd8914a798415f1d84fafc0ebfca3eb8d87b38cc84ac4a1240223a5bf393ba170422efbabb56a33d5dff8faca351b43bacb203b7c75dbdbdbe2c8878c3455b845e1e31141ba0c541299b436b5c215b276c00a6dde3ac4a1240223a5bf393ba170422efbabb56a33d5dff8faca351b43bacb203b7c7aba6d51e606f3e6a3ecd7145b35908eed333123fe2648048d74d45b5b4369f3f9e39a936e28c23996b00a617afb1bf734544ae92513315ee668bbbae7fcfc363aba6d51e606f3e6a3ecd7145b35908eed333123fe2648048d74d45b5b4369f3f3731114227a2d5c0b2146e1d9e3e6243ea550854cc976f887ce8de7ed9cf4e0b8f10c45e2d69435e08ece08c9782c8b53285fe74acd67fef19ba7722b230c4083731114227a2d5c0b2146e1d9e3e6243ea550854cc976f887ce8de7ed9cf4e0b3a949e59b4f4c579304f28c2d1daf1d44ea769623c3c36d90cc32b11c495cdbbbc8a3a9b77e90446fb7060ff68ee008ffd6b23b366052207ec225cc163b4dae5be910bc6c653e0ff141d42f2ca96d2315e4b4f0b837d8795df60ef253fd013a0bbb065830edb37fd53b1c004118853176fd8da32ee532cb0d36396088092037401332882cda5b5e52ee14729879370040c4dafd1b7a53ef7bf9fbee299e02babf98fad2df0831e3de579ff511ad8782d9e6698d527bb626e4ddf8cfce40d5f6a449ee1a35e23f21ce4eae352788eeb385f97fa7ec6b738ab277c03ff2fff965de41435a3ac18a69ecd1dfb7ed43507e701e9cfe673e282f457cf1afa583739f5939d1ee904a7b00579bb44719b0286e7524bf560c7ffff6d482064b41b09fdb384b4da9a99bc2ccb78745352cca17a2659b9c9cef70887a36d7fe10b2e6b036f27d86e969ad1f7b0b2c7a0cdee53fd9e36891d4xX"ELPhT$!TTTJiri Popelka - 0.3.9.2-1Jiri Popelka - 0.3.9.1-1Jiri Popelka - 0.3.9-1Jiri Popelka - 0.3.8-1Jiri Popelka - 0.3.7-1Jiri Popelka - 0.3.6.2-1Jiri Popelka - 0.3.6.1-1Jiri Popelka - 0.3.6-1Jiri Popelka - 0.3.5-1Thomas Woerner 0.3.4-1Jiri Popelka Thomas Woerner 0.3.3-2Thomas Woerner 0.3.3-1Jiri Popelka - 0.3.2-2Jiri Popelka - 0.3.2-1Jiri Popelka - 0.3.1-2Thomas Woerner 0.3.1-1Thomas Woerner 0.3.0-1Jiri Popelka - 0.2.12-5Jiri Popelka - 0.2.12-4Fedora Release Engineering - 0.2.12-3Jiri Popelka - 0.2.12-2Thomas Woerner 0.2.12-1Thomas Woerner 0.2.11-2Thomas Woerner 0.2.11-1Thomas Woerner 0.2.10-1Thomas Woerner 0.2.9-1Thomas Woerner 0.2.8-1Jiri Popelka 0.2.7-2Thomas Woerner 0.2.7-1Thomas Woerner 0.2.6-1Thomas Woerner 0.2.5-1Thomas Woerner 0.2.4-1Thomas Woerner 0.2.3-1Thomas Woerner 0.2.2-1Thomas Woerner Thomas Woerner 0.2.1-1Thomas Woerner 0.2.0-2Thomas Woerner 0.2.0-1Thomas Woerner 0.1.3-1Thomas Woerner 0.1.2-1Thomas Woerner 0.1.1-1Thomas Woerner 0.1-1- fix(nftables): batch ipset elements to avoid O(n^2) insertion cost - Resolves: almalinux/almalinux-deploy#186- bump NVR- fix(policy): allow-host-ipv6: allow MLD packets- fix(service): update highest port number for ceph- feat(direct): avoid iptables flush if using nftables backend- feat(rich): support "burst" attribute to limit in rich rules- fix(rich): validate service name of rich rule- feat(icmp): add ICMPv6 Multicast Listener Discovery (MLD) types- feat(rich): support using ipset in destination- fix(nftables): always flush main table on start- fix(ipset): fix configuring IP range for ipsets with nftables- fix(ipset): exception on overlap checking empty set- rebase to v0.9.11- change default CleanupModulesOnExit=yes- feat(config): add CleanupModulesOnExit configuration option - change default CleanupModulesOnExit=yes- fix(zone): detect same source/interface in zones- fix(nftables): rich: source address with netmask- fix(nftables): do not log icmp block if inversion- docs(firewall-*cmd): client conntrack helpers must use a policy- fix(ipset): disallow overlapping entries- fix(policy): warn instead of error for overlapping ports- docs(conf): note that IPv6_rpfilter has a performance penalty- fix(nm): reload: only consider NM connections with a real interface- fix(ipset): fix hash:net,net functionality- fix(direct): rule order with multiple address with -s/-d- rebase to v0.9.3 - fixes from upstream branch stable-0.9- feat(service): add galera service- fix(zone): add source with mac address- fix(rich): non-printable characters removed from rich- fix(nftables): packet marks with masks - fix(nftables): icmp types with code == 0 - fix(rich icmptype): verify rule and icmptype families - fix(zone): cache rule_str for rich rules - improvement(service): IPsec: Update description and add TCP port 4500 - feat(service): add collectd service - feat(service): Add rpc-rquotad.service- fix(cli): add ipset type hash:mac is incompatible with the family parameter - fix(cli): add --zone is an invalid option with --direct - fix: update dynamic DCE RPC ports in freeixpX#L$I drop PostgreSQL patch, fixed upstream- beat the fuzz, rework apr-util-1.2.7-pkgconf.patch- ship find_apu.m4, fix bug #455189- rebuild for new db4-4.7- restore requires for openldap-devel from -devel- properly fix PostgreSQL detection- revert build dependencies, change from -2 didn't help - add apr-util-1.3.2-pgsql.patch (remove pgsql_LIBS during detection)- try adding postgresql-server to build dependencies to pull some libs in- bump up to 1.3.2- bump up to 1.3.0- Autorebuild for GCC 4.3- rebuild for OpenLDAP soname bump- remove all instances of MySQL flags being added to APRUTIL_LDFLAGS- bump up to 1.2.12 - drop MySQL DBD driver, shipped upstream - adjust various patches to apply - rework tests in %check (1.2.x got tests from trunk)- Rebuild for upgrade path (add dist since that's now on F-7 branch)- bump up to 1.2.10 - pick up newly checked in MySQL DBD driver directly from ASF - remove dbdopen patch (fixed upstream) - remove xmlns patch (fixed upstream) - remove autoexpat patch (fixed upstream)- rebuild for fixed APR 32-bit ABI - remove sqlite driver from main package (#274521)- rebuild for expat soname bump- fix License- add rewrite of expat autoconf code (upstream r493791) - fix build for new glibc open()-as-macro - split out sqlite subpackage- add fix for attribute namespace handling in apr_xml (PR 41908)- remove old Conflicts, doxygen BR (#225254)- add DBD DSO lifetime fix (r521327)- drop doxygen documentation (which caused multilib conflicts)- add mysql driver in -mysql subpackage (Bojan Smojver, #222237)- build DBD drivers as DSOs (w/Bojan Smojver, #192922) - split out pgsql driver into -pgsql subpackage- update to 1.2.8, pick up new libpq soname- really rebuild for db45- add support for BDB 4.5 from upstream, rebuild- fix buildconf with autoconf 2.60- rebuild- update to 1.2.7 - use pkg-config in apu-1-config to make it libdir-agnostic- update to 1.2.6 - define LDAP_DEPRECATED in apr_ldap.h (r391985, #188073)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild to drop reference to libexpat.la- disable sqlite2 support - BuildRequire e2fsprogs-devel - enable malloc paranoia in %check- rebuilt again- rebuilt- trim exports from .la file/--libs output (#174924)- update to 1.2.2- fix epoch again- update to 0.9.7 - drop static libs (#170051)- add FILE bucket fix for truncated files (#159191) - add epoch to dependencies- rebuild- update to 0.9.6- restore db-4.3 detection lost in 0.9.5 upgrade- rebuild- update to 0.9.5- actually explicitly check for and detect db-4.3.- rebuild against db-4.3.21.- add security fix for CAN-2004-0786- have -devel require matching release of apr-util- rebuilt- fix use of SHA1 passwords (#119651)- remove fundamentally broken check_sbcs() from xlate code- tweak xlate fix- rebuild with xlate fixes and tests enabled- rebuilt- rename sdbm_* symbols to apu__sdbm_*- fix sdbm apr_dbm_exists() on s390x/ppc64- rebuilt- fix warnings from use of apr_optional*.h with gcc 3.4- drop gdbm support- fix DB library detection- rebuild against db-4.2.52.- rebuild against db-4.2.42.- fix 'apu-config --apu-la-file' output- update to 0.9.4.- rebuild- rebuild - don't run testuuid test because of #98677- rebuild- rebuilt- fix to detect crypt_r correctly (CAN-2003-0195)- fix to try linking against -ldb first (#90917) - depend on openldap, gdbm, db4, expat appropriately.- rebuild- make devel package conflict with old subversion-devel - run the less crufty parts of the test suite- run ldconfig in post/postun- initial build/sbin/ldconfig/sbin/ldconfig 1.6.1-9.el81.6.1-9.el8.build-idabdea39e538d6a2a73d1438e0600c941669d592eapr-util-1libaprutil-1.so.0libaprutil-1.so.0.6.1apr-utilCHANGESLICENSENOTICE/usr/lib//usr/lib/.build-id//usr/lib/.build-id/ab//usr/lib64//usr/share/doc//usr/share/doc/apr-util/-O2 -g xX$Lm;$;;;trootrootrootrootstunnel-5.71-2.el8_10.src.rpmstunnelstunnel(x86-64) @@@@@@@@@@@@@@@@@@@@@@@    @/bin/sh/bin/sh/bin/shlibc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.9)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libcrypto.so.1.1(OPENSSL_1_1_1)(64bit)libdl.so.2()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_0d)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libsystemd.so.0()(64bit)libsystemd.so.0(LIBSYSTEMD_209)(64bit)libutil.so.1()(64bit)libutil.so.1(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)systemdsystemdsystemd3.0.4-14.6.0-14.0-15.2-14.14.3fae1@e@`4@^H^^^%@[s[dC[`O@[W[Z$U:U@UUF@T@Tq@T@Tq@TXTAT5'@T%U@T @SSS@SP@S^BSO@SQQB@QYvQQQ4Q#@PP}L@P OOU@On@ONx@NNP@N6@N @MMRLKsK@KzK^@K@J@JlE@I@IA@II2IsH׈HKHCH2@H1kGGGUA@GF@Et EnEU@E?QDD@D@C@CCQ@CqCqCiCZ)C=(C2BӰB@Bn-@Bn-@B8A@@@@PT@Dw@@,@?2?@>@>z>G@>.>%M@>@>{@=@==@=@<@<<2@;;;s;eL@;\;R@;@:_@:/@:@:@:K+@:CB@:A:@@::9@9%@9[:@9?8)8(87@7@6_Clemens Lang - 5.71-2Clemens Lang - 5.71-2Clemens Lang - 5.71-1Sahana Prasad - 5.56-5Sahana Prasad - 5.56-4Sahana Prasad - 5.56-3Sahana Prasad - 5.56-2Sahana Prasad - 5.56-1Tomáš Mráz - 5.48-5Tomáš Mráz - 5.48-3Tomáš Mráz - 5.48-2Tomáš Mráz - 5.48-1Tomáš Mráz - 5.46-1Tomáš Mráz - 5.44-5Fedora Release Engineering - 5.44-4Igor Gnatenko - 5.44-3Tomáš Mráz - 5.44-2Tomáš Mráz - 5.44-1Tomáš Mráz - 5.42-1Fedora Release Engineering - 5.41-3Fedora Release Engineering - 5.41-2Neal Gompa - 5.41-1Neal Gompa - 5.40-1Fedora Release Engineering - 5.35-2Tomáš Mráz - 5.35-1Tomáš Mráz - 5.34-1Tomáš Mráz - 5.30-1Avesh Agarwal - 5.18-1Fedora Release Engineering - 5.17-2Avesh Agarwal - 5.17-1Avesh Agarwal - 5.16-1Avesh Agarwal - 5.15-1Avesh Agarwal - 5.14-1Avesh Agarwal - 5.13-1Avesh Agarwal - 5.12-1Avesh Agarwal - 5.11-1Avesh Agarwal - 5.10-1Avesh Agarwal - 5.09-1Avesh Agarwal - 5.08-1Avesh Agarwal - 5.08b6-1Avesh Agarwal - 5.07-1Avesh Agarwal - 5.06-1Avesh Agarwal - 5.05b5-1Avesh Agarwal - 5.04-2Avesh Agarwal - 5.04-1Avesh Agarwal - 5.03-1Fedora Release Engineering - 5.02-2Ax`X%L S9$.999stname, in an attempt to get more of the tests to run properly during builds - pull in Simo's patch to recognize "client_keytab" as a key type which can be passed in to gss_acquire_cred_from() (RT#7598)- pull up Simo's patch to mark the correct mechanism on imported GSSAPI contexts (RT#7592) - go back to using reconf to run autoconf and autoheader (part of #925640) - add temporary patch to use newer config.guess/config.sub (more of #925640)- fix a version comparison to expect newer texlive build requirements when %{_rhel} > 6 rather than when it's > 7- Add libverto-devel requires for krb5-devel - Add otp support- fix a memory leak when acquiring credentials using a keytab (RT#7586, #911110)- prebuild PDF docs to reduce multilib differences (internal tooling, #884065) - drop the kerberos-iv portreserve file, and drop the rest on systemd systems - escape uses of macros in comments (more of #884065)- update to 1.11.1 - drop patch for noticing negative timeouts being passed to the poll() wrapper in the client transmit functions- set "rdns = false" in the default krb5.conf (#908323,#908324)- update to 1.11 release- update to 1.11 beta 2- when building with our bundled copy of libverto, package it in with -libs rather than with -server (#886049)- update to 1.11 beta 1- handle releases where texlive packaging wasn't yet as complicated as it is in Fedora 18 - fix an uninitialized-variable error building one of the test programs- move the rather large pile of html and pdf docs to -workstation, so that just having something that links to the libraries won't drag them onto a system, and we avoid having to sort out hard-coded paths that include %{_libdir} showing up in docs in multilib packages - actually create %{_var}/kerberos/kdc/user, so that it can be packaged - correct the list of packaged man pages - don't dummy up required tex stylesheets, require them - require pdflatex and makeindex- update to 1.11 alpha 1 - drop backported patch for RT #7406 - drop backported patch for RT #7407 - drop backported patch for RT #7408 - the new docs system generates PDFs, so stop including them as sources - drop backported patch to allow deltat.y to build with the usual warning flags and the current gcc - drop backported fix for disabling use of a replay cache when verifying initial credentials - drop backported fix for teaching PKINIT clients which trust the KDC's certificate directly to verify signed-data messages that are signed with the KDC's certificate, when the blobs don't include a copy of the KDC's certificate - drop backported patches to make keytab-based authentication attempts work better when the client tells the KDC that it supports a particular cipher, but doesn't have a key for it in the keytab - drop backported fix for avoiding spurious clock skew when a TGT is decrypted long after the KDC sent it to the client which decrypts it - move the cross-referenced HTML docs into the -libs package to avoid broken internal links - drop patches to fixup paths in man pages, shouldn't be needed any more- tag a couple of other patches which we still need to be applied during %{?_rawbuild} builds (zmraz)- actually pull up the patch for RT#7063, and not some other ticket (#773496)- add patch based on one from Filip Krska to not call poll() with a negative timeout when the caller's intent is for us to just stop calling it (#838548)- on EL6, conflict with libsmbclient before 3.5.10-124, which is when it stopped linking with a symbol which we no longer export (#771687) - pull up patch for RT#7063, in which not noticing a prompt for a long time throws the client library's idea of the time difference between it and the KDC really far out of whack (#773496) - add a backport of more patches to set the client's list of supported enctypes when using a keytab to be the list of types of keys in the keytab, plus the list of other types the client supports but for which it doesn't have keys, in that order, so that xآX&!LH`O$mOONe against a Kaminsky attack - Enable val-clean-additional to drop addition unsigned data from signed response. - Removed patches (got merged into upstream)- Modified scandir patch to silently fail when wildcard matches nothing - Patch to allow unbound-checkconf to find empty wildcard matches- Added scandir patch for trusted-keys-file: option, which is used to load multiple dnssec keys in bind file format- Added Requires: for selinux-policy >= 3.5.13-33 for proper SElinux rules.- We did not own the /etc/unbound directory (#474020) - Fixed cvs anomalies- removed all obsolete chroot related stuff - label control certs after generation correctly- Updated to unbound 1.1.1 which fixes a crasher and addresses nlnetlabs bug #219- Remove the chroot, obsoleted by SElinux - Add additional munin plugin links supported by unbound plugin - Move configuration directory from /var/lib/unbound to /etc/unbound - Modified unbound.init and unbound.conf to account for chroot changes - Updated unbound.conf with new available options - Enabled dns-0x20 protection per default- unbound-1.1.0-log_open.patch - make sure log is opened before chroot call - tracked as http://www.nlnetlabs.nl/bugs/show_bug.cgi?id=219 - removed /dev/log and /var/run/unbound and /etc/resolv.conf from chroot, not needed - don't mount files in chroot, it causes problems during updates - fixed typo in default config file- Updated to version 1.1.0 - Updated unbound.conf's statistics options and remote-control to work properly for munin - Added unbound-munin package - Generate unbound remote-control key/certs on first startup - Required ldns is now 1.4.0- Only call ldconfig in -libs package - Move configure into build section - devel subpackage should only depend on libs subpackage- Fix CFLAGS getting lost in build - Don't enable interface-automatic:yes because that causes unbound to listen on 0.0.0.0 instead of 127.0.0.1- Split off unbound-libs, make build verbose- FSB compliance, chroot fixes, initscript fixes- Upgraded to 1.0.2- upgraded to new release- Build against ldns-1.3.0- Split of -devel package, fixed dependancies, make rpmlint happy- Using parts from ports collection entry by Jaap Akkerhuis. - Using Fedoraproject wiki guidelines.- Initial version./bin/sh/bin/sh/bin/sh/bin/sh 1.16.2-5.14.el8_101.16.2-5.14.el8_101.16.2-5.14.el8_10 unboundicannbundle.pemroot.key.build-id45b424a39acacdbc6bae5f5c0f25973bd09253f46715b88e4ef2d4d3332ac0513e0a48d534dcb33funbound-anchor.serviceunbound-anchor.timerlibunbound.so.2libunbound.so.2.7.18unbound-anchorunbound-libsREADMEunbound-libsLICENSEunbound-anchor.8.gzunboundroot.key/etc//etc/unbound//usr/lib//usr/lib/.build-id//usr/lib/.build-id/45//usr/lib/.build-id/67//usr/lib/systemd/system//usr/lib64//usr/sbin//usr/share/doc//usr/share/doc/unbound-libs//usr/share/licenses//usr/share/licenses/unbound-libs//usr/share/man/man8//var/lib//var/lib/unbound/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryASCII text, with very long linesASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=45b424a39acacdbc6bae5f5c0f25973bd09253f4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linuxPX'L8K$KKX#ijq0ffaf8b7fcc5ccb016be80720ed0951b393ea56d2f9ac6e373551c16e46988d5b18f48e59137b90f94a4856f9348abd1a2f5641be26d30c2cd54366316c005118c2d8e6365e3407e79d9b2c54d7df48cbcea69c2f461cbfde22d8a8024e0e9a6d6f982c5030f1a82c8b159a97b7c356cc6db57ce8c239fa3b1ab2033db4a918f65f9fea233f6d823db41d2d24dbe24c3a0089a6961fb34edc9d99456807013002535efdbcd7ab6c8c7a7d9432b98e9318bb457e781544e2b543442f70ff5a78e1d17509c578c77df4517603f9ae5abb859ccd3ca5a507c98b45a9057076baed92d31e5be8a5b3ad77c6dbc7b34f6e727f9bdeb28270b1c85214b85156b1b5634d61762c57528817e13d44af1f28ecdc3901f2abf9d63411b3410e38d8459bc16345b832fa3a028458b88bd965863901b4588537be51d6325986a2a4f27a0dc84c668b574ee57bdf9eb2e8f64961339c57a32d8f3405d862f18b395fe996ffc14fae71440db5c96b7fc8d74f2eb3abdc0fd47f1754798e6d0f0ee5cdce42d4922faef84920d27f12aeb8f1d75a906804ab2eea9e71eba85b907321a9cdcd9cf1d53148625082286c708a4ed6f5e3181c50608f3ca7a58e627b9be304ac0351abe83d83515eac30cb284dba5e61caa3c68cb3ce9797b1e7aa43783223a2746723c07ecb526d37679a6e6ce23711622183812751ff9ef272c3a094775e65801d17480cef3f866cda4308d7a00187463d55ddea709c73fde8c486587e90dbec37da45b5ca002589baf999576b0c1b582dce2e3f1c44f2e173390bc979ecd2821c62053f5a800a6662d500bc676339067b4fcd793e92133dec850898fc7bfc258f440e10811d2a5deed17d0723bd7ed99138974f47b8dc0cb948408a4d453e7b4160b904661cab4cfe21916dfc7bb794d03839ffbbc7a041fe2669c60b40adb129aed2f64b21f532c924f5390aba408c410f9392ce0a665298ea4830aad3d9033b9c4da1c4bf53a110be0c6b861e42fe5c900e9855fc6c89da7fbd48c57d77cc809a11cda5b90e0a829e2e875ae7d230741ddd1f87c8563bec3db3019eb275696af72b6254ef9534fe1530df14a2692b7fe25b2e5990a6c78f92a04c77e3c3bb3bc8ddd7b253760624ca5840234d04fd2895b99a52b2ec637080189e37d25e2bdb1bc9a47a91f40324a6b6be77a6fb0fad0262bc7f2e5ef034ef3554e6deea23e7eb5375fb010eaa50d615de870bf3031213daba7263dab9067c1ae9cddff8b34022da2b77fa52487f9b4915694f56b8c051ac7173672d5836552b4550caff625cf83eac6f994dcbbf8bb06d78efae16abc599fa511cfbd7cde134e7ed7c21f2529f28edc3c4eb0dd3c268efa27a409b84896a5bafa790305a7cdf0fe85641c28fb5a9b1d4ce4826569bc8ff7d8b55c823d28d6c24212ed381d0f44fa9d3203298cc0e5a968396db5ceec9fb369e7a94911354bd5cabfcbcc6b8cd70c8a45c2b40e8b2a187ea198e57dce523b411f93c1934166de581ddc314b60641196a6024fbd9359e585ad28dc311812adf0be611edde79dc698e13cb2b45070a264e88358a10d25ce6c904c1b78fefcac4f15332c6df61373a618fd458a7e87760b70ac4c0b37a9a65ed3f3c29c2dfcde63024f0f86fb9083d14b3a97593b0421b9546e2bf3d242e1beccafc118219aa122eee961fbf186b550b42317fc906a082e572e77b476676a3de68e56856e0fe34221c2f5388cbbb68df2e630f654e61d4e4027da8a20566b68f75a9bb46e23869519c46b2bd90e7f2f0ff6202584345a120ff1f2b0582ef1e20ea2cf1d7a361780bd0b54d41d9fd818ae0a1e51e2599510dabfb76d73d506dbcf55b9086970c94c024b08a324f5d3dd04324a5e9b557ab868376d7aaeded7a04cdb9ee1bb4e8db097a62dc187c3957188248ef528c66e4bc3ac629f8dac4cf23ac8994f58bc12843493e5924d5d38520d7ef4011632fa06d83607a5bf0a1a752b6666be31e2608cf89dc5bee47572c28fa722e28b15cbbe19da0388d19c49f17e06c953f1a7ae5ed33a76922c9e7d8ee66df8df5a112470814cef7e5b3d98d0384b52d07fdb7a3d8b83652243c51d65ae267e1ea323f34f3e58f32873b042753c1b4f10105ce97f6fae19840e2a06eb31a2062584d4ac4e7c591f5f0f872ee20f50d46a31669a35ec54e19f57efad9f4c4e368365a7f2fb3fe7cabbd2fd6d60edc51ae56ae203cebac839cd1d5e47419272508702b8069460b815b65fb1feb5d523484e201c93853be21b37f4b5cd1aec9c19ae13c87ecf2c0af12aa15db17bad8e7b04b392badd00971200a75c34c01780f8dbeb05c7a56a22407bdef940dcbaae2c6523752eef0839a93c0b261d6f282d6c34cb8266566f322044a49623a55e9fe74d23410c3ca63c445054c3ecb0d4973a8e44ed96795cc1b60d7ba9dd2e2cb5deecf37ec6e99183083fb1ff93ff045dd47c70ea40108a051a92492fc9a94fd0a2f82c744bd52d9d8682315772585ced15ac5111e3f6263e98e1e27930c3f14b91ca8570764909dcce33e0771d6985e42027871d2291cb6e4f69154f1d058f81040fdad3fc5080fdc8e3f519ed7cc9b567c29228dbad2196c5cf273d4ce976bb39b1d0e496c3cc0a1f6a5606b345767c6385439f898680da842db8d07c90ad990a142e218f151ded08c78f856821c98e0314b44f480ed0581fca3d291d1daa73a4be1e1e62b3c50ea5bdb2ec9296b9f338611434417d09beb251ee5e7a0260339f510xX(JLdT$&TTTAdded remaining sections zone, service, .. - firewallctl: Added runtime-to-permanent, interface and source parser, IndividualCalls setting - firewall.server.config: Allow to set IndividualCalls property in config interface - Fix missing icmp rules for some zones - runProg: Fix issue with running programs - firewall-offline-cmd: Fix issues with missing system-config-firewall - firewall.core.ipXtables: Split up source and dest addresses for transaction - firewall.server.config: Log error in case of loading malformed files in watcher - Install and package the firewallctl man page - New firewallctl utility (RHBZ#1147959) - doc.xml.seealso: Show firewalld.dbus in See Also sections - firewall.core.fw_config: Create backup on zone, service, ipset and icmptype removal (RHBZ#1339251) - {zone,service,ipset,icmptype}_writer: Do not fail on failed backup - firewall-[offline-]cmd: Fix --new-X-from-file options for files in cwd - firewall-cmd: Dropped duplicate setType call in --new-ipset - radius service: Support also tcp ports (RBZ#1219717) - xmlschemas: Support source-port, protocol, icmp-block-inversion and ipset sources - config.xmlschema.service.xsd: Fix service destination conflicts (RHBZ#1296573) - firewall-cmd, firewalld man: Information about new NetworkManager and ifcfg - firewall.command: Only print summary and description in print_X_info with verbose - firewall.command: print_msg should be able to print empty lines - firewall-config: No processing of runtime passthroughs signals in permanent - Landspace.io fixes and pylint calm downs - firewall.core.io.zone: Add zone_reader and zone_writer to __all__, pylint fixes - firewall-config: Fixed titles of command and context dialogs, also entry lenths - firewall-config: pylint calm downs - firewall.core.fw_zone: Fix use of MAC source in rich rules without ipv limit - firewall-config: Use self.active_zoens in conf_zone_added_cb - firewall.command: New parse_port, extended parse methods with more checks - firewall.command: Fixed parse_port to use the separator in the split call - firewall.command: New [de]activate_exception_handler, raise error in parse_X - services ha: Allow corosync-qnetd port - firewall-applet: Support for kde5-nm-connection-editor - tests/firewall-offline-cmd_test.sh: New tests for service and icmptype modifications - firewall-offline-cmd: Use FirewallCommand for simplification and sequence options - tests/firewall-cmd_test.sh: New tests for service and icmptype modifications - firewall-cmd: Fixed set, remove and query destination options for services - firewall.core.io.service: Source ports have not been checked in _check_config - firewall.core.fw_zone: Method check_source_port is not used, removed - firewall.core.base: Added default to ZONE_TARGETS - firewall.client: Allow to remove ipv:address pair for service destinations - tests/firewall-offline-cmd_test.sh: There is no timeout option in permanent - firewall-cmd: Landscape.io fixes, pylint calm downs - firewall-cmd: Use FirewallCommand for simplification and sequence options - firewall.command: New FirewallCommand for command line client simplification - New services: kshell, rsh, ganglia-master, ganglia-client - firewalld: Cleanup of unused imports, do not translate some deamon messages - firewalld: With fd close interation in runProg, it is not needed here anymore - firewall.core.prog: Add fd close iteration to runProg - firewall.core.fw_nm: Hide NM typelib import, new nm_get_dbus_interface function - firewalld.spec: Require NetworkManager-libnm instead of NetworkManager-glib - firewall-config: New add/remove ipset entries from file, remove all entries - firewall-applet: Fix tooltip after applet start with connection to firewalld - firewall-config: Select new zone, service or icmptype if the view was empty - firewalld.spec: Added build requires for iptables, ebtables and ipset - Adding nf_conntrack_sip module to the service SIP - firewall: core: fw_ifcfg: Quickly return if ifcfg directory does not exist - Drop unneeded python shebangs - Translation updatx0qX)L~ $J-pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=abdea39e538d6a2a73d1438e0600c941669d592e, strippedUTF-8 Unicode textASCII textPR RRRRR RRRR R RRR RRapr-util-bdb(x86-64)apr-util-openssl(x86-64)1.6.1-9.el81.6.1-9.el8utf-8380abebf13c2a80e027a70f3d3846ffc356fd509c77da62ad586a6ed43489768?!<ΰQd~e- Qd~ꪼ D`Á7E]={5m!@kգ::SX[ /^XPDu)6|RP'keL5zL058F7;tQ#8xQGn!<ΰQd~e- Qd~? p'z):M.4IRj( DzeП4MQ%W&tcR{THE|2`*18.9Փ4Է%r0OEsD,V'~h1/>F2GTJsWaY^`c.mox3_#|AP1,8( Vpv]">'럂U.!L*xxT!b{ 91P(oC'z z;]ҟ$ A$c ͑/6EA?u A1_͚L>va'(]Gŭ"k-ds3+b[*UYQa҄2T~LC\@жO^ܲ&yv khd63b419d54d09cc521d73b28420f583249ef126d0675a45654b53dd4dbe211543ebd3d1b02220c2c79605e9bfd963c1fa6b71161j{xhj{xuctor.3ssl.gz1- iUI_method_get_opener.3ssl.gz-, UI_method_get_flusher.3ssl.gz+ eUI_method_get_ex_data.3ssl.gz* i%UI_method_get_data_duplicator.3ssl.gz) s%UI_method_get_data_destructor.3ssl.gz( UI_method_get_closer.3ssl.gz3eURI::file.3pm.gzr3oURI::data.3pm.gz3 eURI::_punycode.3pm.gz3 qURI::WithBase.3pm.gze3 fURI::URL.3pm.gzrb3 URI::Split.3pm.gz3 rURI::QueryParam.3pm.gzc35URI::Heuristic.3pm.gz3URI::Escape.3pm.gzml- 43eaURI.pm3 URI.3pm.gzane3eURI-f^Ki UNICODE.so' UI_get_string_type.3ssl.gz & #UI_get_result_string_length.3ssl.gzro% TUI_get_result_minsize.3ssl.gz$ UUI_get_result_maxsize.3ssl.gz# 0UI_get_result_length.3ssl.gz0" TUI_get_method.3ssl.gz! TUI_get_input_flags.3ssl.gz eUI_get_ex_new_index.3ssl.gz IUI_get_ex_data.3ssl.gz8 TUI_get_default_method.3ssl.gz UI_get0_user_data.3ssl.gz IUI_get0_test_string.3ssl.gzJI sUI_get0_result_string.3ssl.gz eUI_get0_result.3ssl.gz CUI_get0_output_string.3ssl.gz TUI_get0_action_string.3ssl.gz BUI_free.3ssl.gz FUI_dup_verify_string.3ssl.gzV 5UI_dup_user_data.3ssl.gz5 FUI_dup_input_string.3ssl.gz-H 5UI_dup_input_boolean.3ssl.gzU dUI_dup_info_string.3ssl.gzT UUI_dup_error_string.3ssl.gzCN cUI_destroy_method.3ssl.gz ,UI_ctrl.3ssl.gz6- +UI_create_method.3ssl.gzT UUI_construct_prompt.3ssl.gzCN PUI_add_verify_string.3ssl.gzT &UI_add_user_data.3ssl.gz# iUI_add_input_string.3ssl.gzaE fUI_add_input_boolean.3ssl.gz. UI_add_info_string.3ssl.gzvx`X*LxD Xo$% on full relabel- Make restorecond not start by default - Fix polgengui to allow defining of confined roles. - Add patches from Lubomir Rintel * Add necessary runtime dependencies on setools-console for -gui * separate stderr when run seinfo commands - Update to upstream * Update semanage man page for booleans from Dan Walsh. * Add further error checking to seobject.py for setting booleans.- Uninvasive (ie no string or widget changes) HIG approximations in selinux-polgenui- Move s-c-selinux to the right menu- Fix boolean descriptions - Fix semanage man page- Don't use prefix in gui- Update to upstream * Update audit2allow to report dontaudit cases from Dan Walsh. * Fix semanage port to use --proto from Caleb Case.- Update to upstream * Fix for segfault when conf file parse error occurs.- Don't show tabs on polgengui- Update to upstream * Merged fix fixfiles option processing from Vaclav Ovsik. - Added existing users, staff and user_t users to polgengui- Add messages for audit2allow DONTAUDIT- Add ability to transition to roles via polgengui- Update to upstream * Make semodule_expand use sepol_set_expand_consume_base to reduce peak memory usage.- Update to upstream * Merged audit2why fix and semanage boolean --on/--off/-1/-0 support from Dan Walsh. * Merged a second fixfiles -C fix from Marshall Miller.- Don't initialize audit2allow for audit2why call. Use default - Update to upstream * Merged fixfiles -C fix from Marshall Miller.- Update to upstream * Merged audit2allow cleanups and boolean descriptions from Dan Walsh. * Merged setfiles -0 support by Benny Amorsen via Dan Walsh. * Merged fixfiles fixes and support for ext4 and gfs2 from Dan Walsh.- Update to upstream * Merged replacement for audit2why from Dan Walsh.- Cleanup fixfiles -f message in man page- Update to upstream * Merged update to chcat, fixfiles, and semanage scripts from Dan Walsh. * Merged sepolgen fixes from Dan Walsh.- handle files with spaces on upgrades- Add support in fixfiles for ext4 ext4dev and gfs2- Allow files with spaces to be used by setfiles- Add descriptions of booleans to audit2allow- Update to upstream * Merged support for non-interactive newrole command invocation from Tim Reed.- Change to use selinux bindings to audit2why- Fix fixfiles to handle no args- Fix roles output when creating a module- Handle files with spaces in fixfiles- Catch SELINUX_ERR with audit2allow and generate policy- Make sepolgen set error exit code when partial failure - audit2why now checks booleans for avc diagnosis- Update to upstream * Update Makefile to not build restorecond if /usr/include/sys/inotify.h is not present- Fix sepolgen to be able to parse Fedora 9 policy Handle ifelse statements Handle refpolicywarn inside of define Add init.if and inetd.if into parse Add parse_file to syntax error message- Add scroll bar to fcontext gui page- Add Russion Man pages- Upgrade from NSA * Drop verbose output on fixfiles -C from Dan Walsh. * Fix argument handling in fixfiles from Dan Walsh. * Enhance boolean support in semanage, including using the .xml description when available, from Dan Walsh. - Fix handling of final screen in polgengui- Fix handling of disable selinux button in gui- Upgrade from NSA * load_policy initial load option from Chad Sellers.- Don't show error on missing policy.xml- GUI Enhancements - Fix cgi generation - Use more patterns- Remove codec hacking, which seems to be fixed in python- Fix typo - Change to upstream minimal privledge interfaces- Fix fixfiles argument parsing- Fix File Labeling add- Fix semanage to handle state where policy.xml is not installed- Remove -v from restorecon in fixfiles- Fix filter and search capabilities, add wait cursor- Translate booleans via policy.xml - Allow booleans to be set via semanage- Require use of selinux-policy-devel- Vax PX+" L pfD$vfDeDgDedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Revert broken fix for is keyboard (#826220)- xkeyboard-config 2.6 - change source URL, 2.6 is in a different directory - force autoreconf, update to use intltoolize as autopoint- Add upstream patch to fix OLPC azerty keyboard- xkeyboard-config 2.5.1- xkeyboard-config 2.5- Move Ungrab and ClearGrab from the default layout to option grab:break_actions (#783044)- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Change Serbian layouts to mark the cyrillic ones (#769751)- xkeyboard-config 2.4.1 - change source URL from ftp.x.org to http://xorg.freedesktop.org, ftp takes too long to update- Add 0001-Use-XSL-to-generate-man-page-from-the-rules-XML.patch, ship man-page - Fix up broken git repo initialization when building from a tarball- xkeyboard-config 2.3- Snapshot from git to fix French Canadian layouts (#694472)- xkeyboard-config 2.2.1, 2.2 had a broken configure check - Add new BR and don't disable build/runtime deps checks- xkeyboard-config 2.2 - reinstate the git bits removed in previous commit- Update to 2.1.99 release- add bits required to build from git - update to today's git snapshot- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- xkeyboard-config 2.1  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIx?X,jLC$SCB^ c rebuild- FHS packaging. - update to 0.17-pre20000412.- moved the xinet entry to the server- add an entry to /etc/xinetd.d- permit telnet queries only for exported variables.- 0.17- rebuild for sparc baud rates > 38400.- fix description- wmconfig gone- man pages are compressed - fix description- split client and server- update to 0.16.- corrected the Terminal setting of the .desktop (needs to be 'true' not '1')- red hat .desktop entry- rebuild for 6.1.- don't trust random TERM variables in telnetd (#4560)- fix (#3098).- fixed the problem with escape character (it could not be disabled) - changed the spec file to use %setup macro for unpacking telnet-client- use glibc utmp routines.- fix the fix (wrong way memcpy).- fix "telnet localhost" bus error on sparc64 (alpha?).- use OpenBSD telnet client (and fix minor core dump with .telnetrc #247)- use openpty in telnetd- auto rebuild in the new build environment (release 22)- compile for 6.0.- translations modified for de, fr, tr- compile C++ code using egcs- built against new ncurses- added wmconfig entry- initial build1:0.17-76.el81:0.17-76.el8telnet.build-id5febb65c359376c2ab8517e5f1e06dd423e9fc88telnetREADMEtelnet.1.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/5f//usr/share/doc//usr/share/doc/telnet//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5febb65c359376c2ab8517e5f1e06dd423e9fc88, strippeddirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) RRRRRRRR RR RRutf-8db5095d8a0800b41e81c8f0961ac374af6840c4578c2ab30bce9b6a2d4b23a6b?0 !<ΰQd~`qK Qd~ i"\+q@^"eQ1p 1rW,j!\eqkDcC;Þ'uX9'v(ɨ<M k{sEK?/:.?Nx} {H꭪lIQz! c>GQlt볤_n8͚~]s~V\Xh@Y0P^.ua٦`8ym"AG* q?燎ܬЉM %abl]~]"]+? -hS2 iJ]w1m>0 .Z͙+ZE:LܪhtzbC?}gOIL *ɏB;I "\H#cc261bdaeee110a65ac2dc204ea3b7314c860d0fea9e087b4c870c0e103c4371945a7d93c7cf40bc0f07b1ee06c58bfc7e3c5f4fj{yj{xfile::Win32)4 cpanel-perl(URI::file::Unix)h4rcpanel-perl(URI::file::QNX)en4 cpanel-perl(URI::file::OS2) -4scpanel-perl(URI::file::Mac)it4rcpanel-perl(URI::file::FAT)up4ecpanel-perl(URI::file::Base)i4scpanel-perl(URI::file)ld 4rcpanel-perl(URI::data)acc4rcpanel-perl(URI::_userpass) M4ncpanel-perl(URI::_server)4gcpanel-perl(URI::_segment)id 4ecpanel-perl(URI::_query)t4 hcpanel-perl(URI::_punycode)on4 acpanel-perl(URI::_login)k4 cpanel-perl(URI::_ldap)hexء.XYLH*$r***7a9e6666aaa07d487a5d8aa39ef0a37172ceab490aaa44f659a04d4e4021fa0012b1c539dc7f54bdc9e49032c3ac375085e24cf822cacae22bf6a719f1a1643fd08c53fe75825829ad717a4171b00fbccbbf82d7309f9a28e5927598fb27ab7cfa8fcdd629e90194b866d999ef5d9b3f248bab07d5eb5b774f7825802b28c4ce570b61fefeb63fa88df16a269057ae2068091eff94835cc9ab8fcaeeb293d36624f7aad6a4d02bceebdef03d25b2cabb647d9999c1dac8bb7f922d3547271dec2c6c57f8c0058cf30138e36a2898139618c0f5a8eb94b008f074c543e32b46f8ea959ff3a0a32c0b15567525dea375cef8ae96dd5b758bc23f1f582452f7a2bf35122e77862166d98f37634637762d925521783b5edd414b05708df2df94d7d0cd4109aebf11344fc28ea6e8f805a75660c9a840a6dc38fd6584b34d35b6e5bd2c35f7976d56cf33080708503a147b97f302cb129b51cb9b177cd129b4cc3da6066105364c816fb0baedfe490e0b4dffe5db908438e92f764c487279290b5ae17372ff01571d27ee3e479304e7aa2fa7894a32d247fba3fe5debdaf8e45832a2bdf1b55a90f64d0ecacc4832b41581b005f5240e323d4cc004846ebc90d184d39eb06a038fe5ff2ef983fed69724474ffd65c3b79b564f9a75218ede38644208fead9d94fd2d7f72dc3dd9a38107bec6fd2dd6f9a5798c5657bbcf25c333c9535cb2b38ca175dc4ab6e5b0345b59b2755b9494971305283684cdb2902ae58e13cac7c1e0abe76ee0fac22ecdcef7cb497798a45359de9621125d8d9b71d636ef99ab07174dd1b221e6b9f16b3b3f9bc96eed4fde4b1bdbc172e87a2dded4ad5803ff1ec5505f7d5439500de7127f700f0615857b390e5173eddd4dc464bd7a60c6f1c244a15d95faede11f865fe1c7140d8ae7f80eee32942170abad3f4ffa94d6b46890366f960c56924e445ebcc3b2d45aef770dac47264a5bf58e4fdf48ffc3354309f8e6c97081b543684022ed71c13b1670d9d661308430bfb5cc45e357e54c93827b55c8dcf673f3fd41242e5991d2fb15d4f5eabdb59526955cda0103f4101197ac2c50c97e873b4138d3989113213935a0196eab633ea7a01ec06ee8ae04913c05406cfeaa76e24fa6c8975964acd429f52241ff20823f37efe621a5f4bdb8e057e43c3ffda1d2b31e5ac0d8a1b2518473cbf2e8ab04e5d614f36a2cc476981278a7ec963aec44b34306b51afe5b59a89df4892a343873f2d2ec316d29aff4530c26be2210d12f13a2b1d3f6ae4622d4b652cfbd80944932deac803334201e0592ca9d828bbed5973637bca4a81a3c50fa732d6382c483df19ada04b5493e02c8ec4796e69766bda22b8d3d5dd4d13736e4278fddbf31521d1fc889487f9a52567ca21314a25797d4481dea1e67fb70a395a4166692090c87d88873daf6446c29e2197f8c5c5f5495b7926ffb6b8a4592d9dc44cc428801bc1ead8fbcfc5ea684f83be5d45cc5c07d0b08fd6cca71f7f66c725d828dba09db3c2d5c8399ca6731b730deec9b3c96cf38899602377f72ba6e1a3b4b858a1325e398315dfaecce2437daa04af01d07886b4d0575dd2505e75b3bcbdf569d2d0b849dbe3376676fe183d143011da2a4dfe3b6e6596ba913fca3089d056ab0a56ee161b24b1eb248abdd11a5bea28727d31eb6e6596ba913fca3089d056ab0a56ee161b24b1eb248abdd11a5bea28727d31e8038fcd4acd65e32d799dd477e11dbffc1e62a158f510d5816f90010bde613b3../../../../usr/bin/greprootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgrep-3.1-6.el8.src.rpm/bin/egrep/bin/fgrep/bin/grepbundled(gnulib)config(grep)grepgrep(x86-64) @@@@@@@@@    @/bin/sh/bin/sh/bin/sh/sbin/install-info/sbin/install-infocoxX.L)(*K$K=K Igor Gnatenko Iryna Shcherbina Jaroslav Škarvada Jason ティビツ Kalev Lember Karsten Hopp Lumir Balhar Marcel Plch Matej Stuchlik Michal Cyprian Michal Toman Miro Hrončok Nicolas Chauvet Orion Poplawski Patrik Kopkan Peter Robinson Petr Šplíchal Petr Viktorin Rex Dieter Richard W.M. Jones Robert Kuska Sahana Prasad Stephen Gallagher Than Ngo Thomas Spura Till Maas Tomáš Hrnčiar Tomas Mraz Tomas Orsava Tomas Radej Toshio Kuratomi Victor Stinner Ville Skyttä Yaakov Selkowitz Zbigniew Jędrzejewski-Szmek  !"!$%$'('*+*-.-0103436789:;<=>?@ABCDEFGHGJKJMNMPPPSTSVVVYZY\]\_`_bcbefehihklknonqrqtutwxwz{z}~}3.12.14-1.el8_103.12.14-1.el8_103.12.14-1.el8_10 .build-id8deef524601ca21fbeddf6417e36f6b402cdd8f9turtle.cpython-312.opt-1.pycturtle.cpython-312.opt-2.pycturtle.cpython-312.pyc_tkinter.cpython-312-x86_64-linux-gnu.sotkinter__init__.py__main__.py__pycache____init__.cpython-312.opt-1.pyc__init__.cpython-312.opt-2.pyc__init__.cpython-312.pyc__main__.cpython-312.opt-1.pyc__main__.cpython-312.opt-2.pyc__main__.cpython-312.pyccolorchooser.cpython-312.opt-1.pyccolorchooser.cpython-312.opt-2.pyccolorchooser.cpython-312.pyccommox XL*+ -$---perl(constant)perl(strict)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)5.6.02.173.0.4-14.6.0-14.0-15.2-14.14.2]:@\@\T4[H@[4Z|;ZKt@YyY_wY3@XW8dV=@UUq@U:S@SQQQP@P H@O/@ON)f@N(N(N(MQ0@MKtK]K@JjI@GPGGMX@F^E@E(@D@CC~@BS@@@?B@Fedora Release Engineering - 1.71-16Jitka Plesnikova - 1.71-15Fedora Release Engineering - 1.71-14Fedora Release Engineering - 1.71-13Jitka Plesnikova - 1.71-12Fedora Release Engineering - 1.71-11Paul Howarth - 1.71-10Fedora Release Engineering - 1.71-9Igor Gnatenko - 1.71-8Jitka Plesnikova - 1.71-7Fedora Release Engineering - 1.71-6Jitka Plesnikova - 1.71-5Fedora Release Engineering - 1.71-4Fedora Release Engineering - 1.71-3Jitka Plesnikova - 1.71-2Tom Callaway - 1.71-1Jitka Plesnikova - 1.66-23Fedora Release Engineering - 1.66-22Fedora Release Engineering - 1.66-21Petr Pisar - 1.66-20Fedora Release Engineering - 1.66-19Jitka Plesnikova - 1.66-18Fedora Release Engineering - 1.66-17Petr Pisar - 1.66-16Fedora Release Engineering - 1.66-15Petr Pisar - 1.66-14Petr Sabata - 1.66-13Petr Sabata - 1.66-12Petr Sabata - 1.66-11Fedora Release Engineering - 1.66-10Marcela Maslanova - 1.66-9Marcela Maslanova - 1.66-8Stepan Kasal - 1.66-7Stepan Kasal - 1.66-6Fedora Release Engineering - 1.66-5Fedora Release Engineering - 1.66-4Tom "spot" Callaway - 1.66-3Tom "spot" Callaway - 1.66-2Tom "spot" Callaway - 1.66-1Jose Pedro Oliveira - 1.65-1Jose Pedro Oliveira - 1.64-1Jose Pedro Oliveira - 1.63-2Jose Pedro Oliveira - 1.63-1Jose Pedro Oliveira - 1.56-4Jose Pedro Oliveira - 1.56-3Michael Schwendt - 1.56-2Jose Pedro Oliveira - 0:1.56-0.fdr.1Ville Skyttä - 0:1.55-0.fdr.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_31_Mass_Rebuild- Perl 5.30 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_30_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Perl 5.28 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Drop POD patch, fixed in 1.67 - Fix source URL to refer to current upstream maintainer - Escape macro used in changelog (#1527541) - Drop legacy Group: and BuildRoot: tags - Drop %defattr, redundant since rpm 4.4 - Use %license where possible - Drop redundant buildroot cleaning - Don't need to remove empty directories from the buildroot - Simplify find command using -delete - Specify all build dependencies - Make %files list more explicit- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuild due to bug in RPM (RHBZ #1468476)- Perl 5.26 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Perl 5.24 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for httpsxxX0L( H${HH0.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.4234-1.cp130~el80.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.42340.4234config_dataBuild.pmAPI.podAuthoring.podBase.pmBundling.podCompat.pmConfig.pmConfigData.pmCookbook.pmDumper.pmNotes.pmPPMMaker.pmDefault.pmMacOS.pmUnix.pmVMS.pmVOS.pmWindows.pmaix.pmcygwin.pmdarwin.pmos2.pmPodParser.pm/usr/local/cpanel/3rdparty/perl/542/bin//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Module//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Module/Build//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Module/Build/Platform/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl script text executablePerl5 module source textPerl POD document, ASCII textutf-83ddfdc5b6b40996ffdfe9561ab42baca1e86c16a9ad48c78aa80830daeba48a7?0~gjʿ/357e81c6690fe34a5e57691b2c52557bdb4045b5390076cfa70b83adb05df6d48a362a9613457831408e232a326d1198341c55b2j{g߼j{Uerl-536-extutils-helpers-windowscpanel-perl-extutils-helperscpanel-perl-extutils-helpers-unixcpanel-perl-extutils-helpers-vmscpanel-perl-extutils-helpers-windows      cpanel-perl-536cpanel-perl-536-carpcpanel-perl-536-exportercpanel-perl-536-file-basenamecpanel-perl-536-file-copycpanel-perl-536-file-spec-functionscpanel-perl-536-strictcpanel-perl-536-text-parsewordscpanel-perl-536-warningsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)5.573.243.0.4-14.6.0-14.0-15.2-14.10.0-14.14.2b@`-@W@S>Busy Camels - 0.026-1.cp108Busy Camels - 0.026-1.cp1198Todd Rinaldo - 0.026-1.cp1162Todd Rinaldo - 0.022-1.cp1146- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: ExtUtils-Helpers 0.026- Update from upstream: ExtUtils-Helpers 0.0220.0260.0260.0260.0260.026-1.cp108~el80.0260.0260.0260.0260.0260.0260.026Helpers.pmUnix.pmVMS.pmWindows.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/ExtUtils//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/ExtUtils/Helpers/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8a52122788b3f8e2b4b376af70105360323ca1a896ef4fc36a943f979dc0512b6?5DWҌek%/7f924f0ebf3c5635e738ed3e14288365beeeab982e15ec8207b23738d1eda063eacc34d0757545614b5bdbd5ccec462153564c13j{{#\j{{kp,-D_GLIBCXX_ASSERxX1eL8Tu$eutvs - Mark features used by ansible, anaconda and subscription-manager as an API- Prevent reinstalling modified packages with same NEVRA (RhBug:1728252,1644241,1760825)- Remove patch to not fail when installing modular RPMs without modular metadata- Fix: --setopt and repo with dots (RhBug:1746349)- Prevent printing empty Error Summary (RhBug:1690414)- Update localizations from zanata (RhBug:1689982) - Accept multiple specs in repoquery options (RhBug:1667898,1656801) - Prevent switching modules in all cases (RhBug:1706215) - Change synchronization of rpm transaction to swdb (RhBug:1737328) - Print rpm error messages during transaction (RhBug:1677199) - Report missing default profile as an error (RhBug:1669527,1724564) - Describe a behavior when plugin is removed (RhBug:1700741)- Add patch to not fail when installing modular RPMs without modular metadata- Update to 4.2.7 - Fix package reinstalls during yum module remove (RhBug:1700529) - Fail when "-c" option is given nonexistent file (RhBug:1512457) - Reuse empty lock file instead of stopping dnf (RhBug:1581824) - Propagate comps 'default' value correctly (RhBug:1674562) - Better search of provides in /(s)bin/ (RhBug:1657993) - Add detection for armv7hcnl (RhBug:1691430) - Fix group install/upgrade when group is not available (RhBug:1707624) - Report not matching plugins when using --enableplugin/--disableplugin (RhBug:1673289) (RhBug:1467304) - Add support of modular FailSafe (RhBug:1623128) - Replace logrotate with build-in log rotation for dnf.log and dnf.rpm.log (RhBug:1702690)- Update to 4.2.6 - Use improved config parser that preserves order of data - Follow RPM security policy for package verification - Update modules regardless of installed profiles - [conf] Use environment variables prefixed with DNF_VAR_ - Allow adjustment of repo from --repofrompath (RhBug:1689591) - Allow globs in setopt in repoid part - Add command abbreviations (RhBug:1634232) - Installroot now requires absolute path - librepo: Turn on debug logging only if debuglevel is greater than 2 (RhBug:1355764,1580022) - Document cachedir option (RhBug:1691365) - Enhance documentation - API examples - Enhance documentation of --whatdepends option (RhBug:1687070) - Update documentation: implemented plugins; options; deprecated commands (RhBug:1670835,1673278) - [doc] Add info of relation update_cache with fill_sack (RhBug:1658694) - Rename man page from dnf.automatic to dnf-automatic to match command name - Fix alias list command (RhBug:1666325) - Fix behavior of ``--bz`` option when specifying more values - Add protection of yum package (RhBug:1639363) - Fix ``list --showduplicates`` (RhBug:1655605) - Retain order of headers in search results (RhBug:1613860) - Solve traceback with the "dnf install @module" (RhBug:1688823) - Fix multilib obsoletes (RhBug:1672947) - Do not remove group package if other packages depend on it - Remove duplicates from "dnf list" and "dnf info" outputs - Fix the installation of completion_helper.py - Fix formatting of message about free space required - Fix installation failiure when duplicit RPMs are specified (RhBug:1687286) - Fix issues with terminal hangs when attempting bash completion (RhBug:1702854) - Allow plugins to terminate dnf (RhBug:1701807) - [provides] Enhanced detecting of file provides (RhBug:1702621) - [provides] Sort the output packages alphabetically- Backport patch to unify --help with man for module-spec (RhBug:1678689)- Backport patch to not allow direct module switch- Backport patch to add support for modular updateinfoxml data- Backport patch: Fix minor problem with suggestion printed to terminal- Backport patches for: RHEL should use --best option by default for dnf / libdnf (RhBug:1670776) - Add --nobest dnf option to revert the new default behavior from commandline- Print information about skipped packages after the transaction - Sort reported skipped packages, force ignore_weak - Allow to enable modules that break default modules (RhBug:1648839)- Updated difference YUM vs. DNF for yum-updateonboot - AxhX2:L(ؿ$hat.com> - 1.11-1Marcela Maslanova - 1.10-4Stepan Kasal - 1.10-3Stepan Kasal - 1.10-2Marcela Mašláňová - 1.10-1Fedora Release Engineering - 1.09-6Fedora Release Engineering - 1.09-5Tom "spot" Callaway - 1.09-4Tom "spot" Callaway - 1.09-3Tom "spot" Callaway - 1.09-2.1Jose Pedro Oliveira - 1.09-2Jesse Keating - 1.09-1.2.1Jason Vas Dias - 1.09-1.2Jesse Keating Jose Pedro Oliveira - 1.09-1Jose Pedro Oliveira - 1.08-7Chip Turner 1.08-6cturner@redhat.com- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 rebuild- 1.12 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Perl 5.24 rebuild- Package cleanup- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 rebuild- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Specify all dependencies. - Update %description.- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Perl mass rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- 661697 rebuild for fixing problems with vendorach/lib- Rebuild 1.11 for perl 5.12 as well- 1.11 version bump- Mass rebuild with perl-5.12.0- fix upstream URL- rebuild against perl 5.10.1- update to new upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for perl 5.10 (again)- rebuild for new perl- correct license tag - add BR: perl(ExtUtils::MakeMaker)- Minor specfile cleanups. - Dist tag.- rebuild- rebuild for new perl-5.8.8- rebuilt for new gcc- Update to 1.09.- Bring up to date with current Fedora.Extras perl spec template. (#156511)- rebuild- Specfile autogenerated1.121.12-4.el8perl-XML-NamespaceSupportChangesREADMEperl-XML-NamespaceSupportLICENSEXML::NamespaceSupport.3pm.gzXMLNamespaceSupport.pm/usr/share/doc//usr/share/doc/perl-XML-NamespaceSupport//usr/share/licenses//usr/share/licenses/perl-XML-NamespaceSupport//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/XML/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m32 -march=x86-64 -mtune=generic -mfpmath=sse -mstackrealign -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnudirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Perl5 module source textPRRRRutf-83aa5d089042e11c37a675093104c0b9d0f9d5345fee8044a689178e0bcdde8b2?@bĉ`7 Qd~j kH!D nc4L}z44Eq`+|Q\i$c,vDggd"EwY8: hL*j^rM̒nFGcxN_ x"(0UDӶJ5+ hpkDdR;E}{] [ڋ7'#PEBO BHʅ Ck7F/ѾEL`Yz%XggٚwLjxX3L9$!999com> - 1.12.1-8Fedora Release Engineering - 1.12.1-7Nathaniel McCallum - 1.12.1-6Nalin Dahyabhai - 1.12.1-5Nalin Dahyabhai - 1.12.1-4Nalin Dahyabhai - 1.12.1-3Nalin Dahyabhai Nalin Dahyabhai - 1.12.1-2Nalin Dahyabhai - 1.12.1-1Nalin Dahyabhai - 1.12-11Nalin Dahyabhai Nalin Dahyabhai - 1.12-10Nalin Dahyabhai - 1.12-9Nalin Dahyabhai - 1.12-8Nalin Dahyabhai - 1.12-7Nalin Dahyabhai - 1.12-6Nalin Dahyabhai - 1.12-5Nalin Dahyabhai Nalin Dahyabhai - 1.12-4Nalin Dahyabhai - 1.12-3Nalin Dahyabhai - 1.12-2Nalin Dahyabhai - 1.12-1Nalin Dahyabhai - 1.12-beta2.0Nalin Dahyabhai - 1.12-beta1.0Nalin Dahyabhai - 1.11.4-2Nalin Dahyabhai - 1.11.4-1Nalin Dahyabhai - 1.11.3-31Nalin Dahyabhai - 1.11.3-30Nalin Dahyabhai - 1.11.3-29Nalin Dahyabhai - 1.11.3-28Nalin Dahyabhai - 1.11.3-27Nalin Dahyabhai - 1.12-alpha1.0Nalin Dahyabhai - 1.11.3-26Nalin Dahyabhai - 1.11.3-25Nalin Dahyabhai - 1.11.3-24Nalin Dahyabhai - 1.11.3-23Nalin Dahyabhai - 1.11.3-22Nalin Dahyabhai - 1.11.3-21Nalin Dahyabhai - 1.11.3-20Nalin Dahyabhai - 1.11.3-19Nalin Dahyabhai - 1.11.3-18Nalin Dahyabhai - 1.11.3-17Nalin Dahyabhai - 1.11.3-16Nalin Dahyabhai - 1.11.3-15Nalin Dahyabhai - 1.11.3-14Nalin Dahyabhai - 1.11.3-13Nalin Dahyabhai - 1.11.3-12Nalin Dahyabhai Nalin Dahyabhai 1.11.3-11Nalin Dahyabhai 1.11.3-10Nalin Dahyabhai 1.11.3-9Nalin Dahyabhai 1.11.3-8Nalin Dahyabhai 1.11.3-7Nalin Dahyabhai 1.11.3-6Nalin Dahyabhai 1.11.3-5Nalin Dahyabhai 1.11.3-4Nalin Dahyabhai 1.11.3-3Nalin Dahyabhai 1.11.3-2Nalin Dahyabhai 1.11.3-1Nalin Dahyabhai 1.11.2-10Nalin Dahyabhai 1.11.2-9Nalin Dahyabhai 1.11.2-8Nalin Dahyabhai 1.11.2-7Nalin Dahyabhai 1.11.2-6Nalin Dahyabhai 1.11.2-5Nathaniel McCallum 1.11.2-4Nalin Dahyabhai 1.11.2-3Nalin Dahyabhai 1.11.2-2Nalin Dahyabhai 1.11.2-1Nalin Dahyabhai 1.11.1-9Nathaniel McCallum - 1.11.1-8Nalin Dahyabhai 1.11.1-7Nalin Dahyabhai 1.11.1-6Nalin Dahyabhai 1.11.1-5Nalin Dahyabhai Nathaniel McCallum 1.11.1-4Nalin Dahyabhai 1.11.1-3Nalin Dahyabhai 1.11.1-2Nalin Dahyabhai 1.11.1-1Nalin Dahyabhai 1.11-2Nalin Dahyabhai 1.11-1Nalin Dahyabhai 1.11-0.beta2.0Nalin Dahyabhai Nalin Dahyabhai 1.11-0.beta1.0Nalin Dahyabhai 1.11-0.alpha1.1Nalin Dahyabhai 1.11-0.alpha1.0Nalin Dahyabhai Nalin Dahyabhai 1.10.3-7Nalin Dahyabhai 1.10.3-6Nalin Dahyabhai 1.10.3-5Nalin Dahyabhai <xXX4Lȥ$"te manifest for u26 production- EA4-260: Update manifest for u26- EA4-249: Add target-os package rename mapping support to ea_current_to_profile - EA4-249: Add ignore_deps support to package rename mappings- CPANEL-48069: Added note fields for error_log and log_errors PHP directives.- EA4-240: Updated manifest to add ioncube15.- EA4-210: 8.1 is EOL end of 2025 so 8.2 is correct for 11-2025’s PHP 8.5 release- EA4-223: Update manifest for ea-nginx-passenger being moved from experimental- EA4-213: Add wappspector dep back to avoid it getting removed erroneously- EA4-212: Update default PHP to 8.2- EA4-205: Add PHP 8.5 to manifest- EA4-94: Update ea4 manifest for mod-passenger on A10- EA4-156: Remove wappspector dep as its moving to update gatherer- EA4-112: Add ea-wappspector dependency- EA4-54: Update manifest- ZC-12937: Remove CentOS 6 from manifest- ZC-12829: Add Ubuntu 24 to system- ZC-12826: Add AL10 to OS aliases- ZC-12810: Preparing for Almalinux 10- ZC-12775: temporarily remove `wpsquared.site` from `tech_domains`- ZC-12773: Fix directory permissions for Ubuntu- ZC-12736: Create webserver traffic logging directory.- ZC-12668: Add tech domains list- ZC-12618: Update manifest for sourceguardian84- ZC-12574: Update manifest for ioncube 14’s PHP 8.4- EA-12626: Update Manifest- ZC-12237: Add PHP 8.4- ZC-12346: Update obs_project_aliases to match reality- ZC-12253: Add ea-ioncube14- ZC-12191: Add ea-apache24-mod-wasm- ZC-12141: Add ioncube and sourceguardian to php83- ZC-4769: Update manifest for ea-apache24-mod-maxminddb- ZC-11823: Add new container package ea-valkey72 to the metainfo and update manifest- ZC-11822: Add ea-nodejs22 to additional packages list and manifest- ZC-11811: Add ea-apache24-mod_cpanel eol.json to recommendations- ZC-11759: Mark ea-tomcat85 as EOL in EA4 recommendations- ZC-11752: Update Manifest for mod lsapi update- ZC-11698: Update manifest for new ea-noop-u20 pkg and recent repo cleanups- ZC-11660: Allow compatibility for profiles which include third-party packages- ZC-11662: Update manifest because of changes to EA4-experimental- ZC-11627: Update manifest under canonical write so its ordered correctly- ZC-11501: Allow compatibility between profiles from RHEL to DEB and vice versa- EA-11937: Remove ea-tomcat85 for CentOS_8 in pkg-manifest.json- ZC-11503: Add PHP 8.0 EOL recommendation- ZC-11475: ea-php83 built for C7- ZC-11175: Adding PHP8.3- ZC-11384: Update deprecated directives for PHP 8.3- ZC-11156: Add ea-ioncube13- ZC-11033: Add support for packages w/out an `ea-` prefix in EA4 profiles - ZC-11135: Add ea-nodejs18 and ea-nodejs20 to additional packages list - ZC-11149: Add touchfile for nginx cpwrap that will ignore memory limits and set it to unlimited to readme- ZC-11122: Add ea-tomcat101 to the manifest.- ZC-10396: Add ea-nginx-echo to `additional_packages`- ZC-11053: Add ea-tomcat101 to container-based package list- ZC-10971: Add support for profile’s `pre` list- ZC-10931: Updated for ea-libc-client- ZC-10955: Update manifest for post reset of OBS flags (Makefile disables only; no manual disables)- ZC-10474: Add ea-nginx-headers-more to `additional_packages` - ZC-10320: Add Ubuntu 22 to manifest- ZC-10561: Add ea-php82-php-memcached- ZC-10899: Add ea-nginx-echo to `additional_packages`- EA-10893: Fix ea_install_profile to return non-zero exit code upon failure- EA-11271: Let `ea_current_to_profile` ignore OpenSSL devel packages under `--target-os`- ZC-10586: Update manifest for new C7 PHP 8.2 pkgs- ZC-10447: update manifest for A9 and PHP 8.2, make PHP 8.1 the default for EA4 - ZC-10581: update ea4 recommendations to match the PHP reality- ZC-10548: have `ea_current_to_profile` ignore `-debuginfo` packages under `--target-os`- ZC-10494: Update PHP INI directive data for PHP 8.2 changes- ZC-10359: Update manifest- ZC-10350: Update manifest- ZC-10009: Add changes so that it builds on AlmaLinux 9- ZC-9918: Correct names of packages on Ubuntu- ZC-9960: Add new container package ea-redis62 toxЪX5L *$* ** ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.22/v2.22-ReleaseNotes - add sulogin, utmpdump, lslocks, wdctl- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- replace udev dependenceis with systemd- upgrade to bugfix release 2.21.2 - fix #814699 - namei(1) incorrectly resolves relative symlinks - fix #820707 - Impossible to unmount nfsv4/krb5 mounts after network disconnect - fix #816877 - libmount does not close device fd before mount(2) - fix #822705 - unable to login after installing- upgrade to bugfix release 2.21.1- upgrade to release 2.21- fix #788703 - /run/blkid does not exist- upgrade to the release 2.21-rc2 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.21/v2.21-ReleaseNotes - add {fsck,mkfs}.minix - add new command chcpu(8) - add new command prlimit(1) - enable raw(8) command - move 60-raw.rules from /etc from /usr/lib/udev/rules.d - move blkid cache from etc to /run/blkid- install everything in /usr https://fedoraproject.org/wiki/Features/UsrMove- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- fix #748216 - util-linux requires pam >= 1.1.3-7 - remove ddate(1)- Rebuilt for glibc bug#747377- upgrade to the release 2.20.1 ftp://ftp.infradead.org/pub/util-linux/v2.20/v2.20.1-ReleaseNotes- upgrade to the release 2.20- upgrade to the release 2.20-rc2 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-rc2-ChangeLog- upgrade to the release 2.20-rc1 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-ReleaseNotes- fix #716483 - /var/tmp --(BIND-mounted)--> /tmp disrupts/hangs bootup - fix #709681 - failure to mount if a mount point ends with a slash in /etc/fstab - fix #709319 - 'mount -a' mounts already mounted directories - fix kernel version parsing- upgrade to the release 2.19.1 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-ReleaseNotes- upgrade to the release 2.19.1-rc1 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-rc1-ChangeLog- fix #682502 - Broken source URL to floppy tarball, new version available - upgrade to floppy-0.18- upgrade to the release 2.19 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes - remove /sbin/mount.tmpfs -- integrated to mount(8)- fix #665062 - add support for the postlogin PAM stack to util-linux-ng- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- upgrade to the release 2.19-rc3 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc3-ChangeLog- upgrade to the release 2.19-rc2 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc2-ChangeLog - fix #671893 - SELinux is preventing /bin/chown from 'setattr' accesses on the file mounts.- clean up specfile (review #667416)- upgrade to the release 2.19-rc1 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes- fix #645640 - new "-s" parameter parsing in agetty does not work - add -l (lock) support to fsck- fix #623685 - please extend agetty to not require a baud rate to be specified- fix #620924 - /sbin/mount.tmpfs uses not available /usr/bin/id- fix #615719 - tmpfs mount fails with 'user' option. - fix #598631 - shutdown, reboot, halt and C-A-D don't work - fix #618957 - ISO images listed in fstab are mounted twice at boot- upgrade to the final 2.18 ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-ReleaseNotes- upgrade to 2.18-rc2 ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-rc2-ChangeLog- upgrade to the release 2.18-rc1 ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-ReleaseNotes ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-rc1-ChangeLog- fix #581252 - remounting tmpfs fails because of hidden rootcontext= - fix #580296 - "rtcwake" does miss the "off" option - fix #575734 - use microsecond resolution for blkid cache entries - upgrade to the bugfix release 2.17.2 ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.2-ReleaseNotes ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.2-ChangeLog -xHX6DL8|0T$ TTTGarver - 0.8.0-4Eric Garver - 0.8.0-3Eric Garver - 0.8.0-2Eric Garver - 0.8.0-1Eric Garver - 0.7.0-5Eric Garver - 0.7.0-4Eric Garver - 0.7.0-3Eric Garver - 0.7.0-2Eric Garver - 0.7.0-1Eric Garver - 0.6.3-7Eric Garver - 0.6.3-6Eric Garver - 0.6.3-5Eric Garver - 0.6.3-4Eric Garver - 0.6.3-3Eric Garver - 0.6.3-2Eric Garver - 0.6.3-1Eric Garver - 0.6.1-5Eric Garver - 0.6.1-4Eric Garver - 0.6.1-3Eric Garver - 0.6.1-2Eric Garver - 0.6.1-1Eric Garver - 0.6.0-2Eric Garver - 0.6.0-1Eric Garver - 0.6.0-0.1.alpha1Eric Garver - 0.5.2-3Eric Garver - 0.5.2-2Eric Garver - 0.5.2-1Igor Gnatenko - 0.5.1-2Eric Garver - 0.5.1-1Fedora Release Engineering - 0.4.4.5-6Igor Gnatenko - 0.4.4.5-5Zbigniew Jędrzejewski-Szmek - 0.4.4.5-4Thomas Woerner - 0.4.4.5-3Fedora Release Engineering - 0.4.4.5-2Thomas Woerner - 0.4.4.5-1Thomas Woerner - 0.4.4.4-1Thomas Woerner - 0.4.4.3-2Thomas Woerner - 0.4.4.3-1Fedora Release Engineering - 0.4.4.2-4Stratakis Charalampos - 0.4.4.2-3Thomas Woerner - 0.4.4.2-2Thomas Woerner - 0.4.4.2-1Thomas Woerner - 0.4.4.1-1Thomas Woerner - 0.4.4-1Thomas Woerner - 0.4.3.3-1Fedora Release Engineering - 0.4.3.2-2Thomas Woerner - 0.4.3.2-1Thomas Woerner - 0.4.3.1-2Thomas Woerner - 0.4.3.1-1Thomas Woerner - 0.4.2-1Thomas Woerner - 0.4.1.2-2Thomas Woerner - 0.4.1.2-1Thomas Woerner - 0.4.1-1Jiri Popelka - 0.4.0-4Jiri Popelka - 0.4.0-3Fedora Release Engineering - 0.4.0-2Thomas Woerner - 0.4.0-1Fedora Release Engineering - 0.3.14.2-5Adam Williamson - 0.3.14.2-4Thomas Woerner - 0.3.14.2-3Thomas Woerner - 0.3.14.2-2Thomas Woerner - 0.3.14.2-1Fedora Release Engineering - 0.3.14.1-3Stephen Gallagher 0.3.14.1-2Thomas Woerner - 0.3.14.1-1Thomas Woerner - 0.3.14-1Stephen Gallagher 0.3.13-7Stephen Gallagher 0.3.13-6Stephen Gallagher 0.3.13-5Stephen Gallagher 0.3.13-4Jiri Popelka - 0.3.13-3Thomas Woerner - 0.3.13-2Jiri Popelka - 0.3.13-1Jiri Popelka - 0.3.12-1Jiri Popelka - 0.3.11-3Jiri Popelka - 0.3.11-2Jiri Popelka - 0.3.11-1Thomas Woerner - 0.3.10-5Thomas Woerner - 0.3.10-4Thomas Woerner - 0.3.10-3Fedora Release Engineering - 0.3.10-2Jiri Popelka - 0.3.10-1Jiri Popelka - 0.3.9.3-1xX7L 1[9$+999(/var/kerberos/krb5kdc) to the newly-added run directory (/run/krb5kdc), in line with what we're expecting in 1.13 (RT#7859, more of #1040056 as #1063905) - add a tmpfiles.d configuration file to have /run/krb5kdc created at boot-time - own /var/run/krb5kdc- refresh nss_wrapper and add socket_wrapper to the %check environment- add currently-proposed changes to teach ksu about credential cache collections and the default_ccache_name setting (#1015559,#1026099)- pull in multiple changes to allow replay caches to be added to a GSS credential store as "rcache"-type credentials (RT#7818/#7819/#7836,- update to 1.12.1 - drop patch for RT#7794, included now - drop patch for RT#7797, included now - drop patch for RT#7803, included now - drop patch for RT#7805, included now - drop patch for RT#7807, included now - drop patch for RT#7045, included now - drop patches for RT#7813 and RT#7815, included now - add patch to always retrieve the KDC time offsets from keyring caches, so that we don't mistakenly interpret creds as expired before their time when our clock is ahead of the KDC's (RT#7820, #1030607)- update the PIC patch for iaesx86.s to not use ELF relocations to the version that landed upstream (RT#7815, #1045699)- pass -Wl,--warn-shared-textrel to the compiler when we're creating shared libraries- amend the PIC patch for iaesx86.s to also save/restore ebx in the functions where we modify it, because the ELF spec says we need to- grab a more-commented version of the most recent patch from upstream master - make a guess at making the 32-bit AES-NI implementation sufficiently position-independent to not require execmod permissions for libk5crypto (more of #1045699)- add patch from Dhiru Kholia for the AES-NI implementations to allow libk5crypto to be properly marked as not needing an executable stack on arches where they're used (#1045699, and so many others)- revert that last change for a bit while sorting out execstack when we use AES-NI (#1045699)- add yasm as a build requirement for AES-NI support, on arches that have yasm and AES-NI- pull in fix from master to make reporting of errors encountered by the SPNEGO mechanism work better (RT#7045, part of #1043962)- update a test wrapper to properly handle things that the new libkrad does, and add python-pyrad as a build requirement so that we can run its tests- revise previous patch to initialize one more element- backport fixes to krb5_copy_context (RT#7807, #1044735/#1044739)- pull in fix from master to return a NULL pointer rather than allocating zero bytes of memory if we read a zero-length input token (RT#7794, part of - pull in fix from master to ignore an empty token from an acceptor if we've already finished authenticating (RT#7797, part of #1043962) - pull in fix from master to avoid a memory leak when a mechanism's init_sec_context function fails (RT#7803, part of #1043962) - pull in fix from master to avoid a memory leak in a couple of error cases which could occur while obtaining acceptor credentials (RT#7805, part of #1043962)- update to 1.12 final- update to beta2 - drop obsolete backports for storing KDC time offsets and expiration times in keyring credential caches- rebase to master - update to beta1 - drop obsolete backport of fix for RT#7706- pull in fix to store KDC time offsets in keyring credential caches (RT#7768, - pull in fix to set expiration times on credentials stored in keyring credential caches (RT#7769, #1031724)- update to 1.11.4 - drop patch for RT#7650, obsoleted - drop patch for RT#7706, obsoleted as RT#7723 - drop patch for CVE-2013-1418/CVE-2013-6800, included in 1.11.4- switch to the simplified version of the patch for #1029110 (RT#7764)- check more thoroughly for errors when resolving KEYRING ccache names of type "persistent", which should only have a numeric UID as the next part of the name (#1029110)- incorporate upstream patch for remote crash of KDCs which serve multiple realms simultaneously (Rx8yX8L h9$U999ttempt to free non-heap memory in libgssapi_krb5 (CVE-2007-5901, #415321) - add backport bug fix for a double-free in out-of-memory situations in libgssapi_krb5 (CVE-2007-5971, #415351)- rework file labeling patch to not depend on fragile preprocessor trickery, in another attempt at fixing #428355 and friends- ftp: add patch to fix "runique on" case when globbing fixes applied - stop adding a redundant but harmless call to initialize the gssapi internals- add patch to suppress double-processing of /etc/krb5.conf when we build with --sysconfdir=/etc, thereby suppressing double-logging (#231147)- remove a patch, to fix problems with interfaces which are "up" but which have no address assigned, which conflicted with a different fix for the same problem in 1.5 (#200979)- ftp: don't lose track of a descriptor on passive get when the server fails to open a file- in login, allow PAM to interact with the user when they've been strongly authenticated - in login, signal PAM when we're changing an expired password that it's an expired password, so that when cracklib flags a password as being weak it's treated as an error even if we're running as root- drop netdb patch - kdb_ldap: add patch to treat 'nsAccountLock: true' as an indication that the DISALLOW_ALL_TIX flag is set on an entry, for better interop with Fedora, Netscape, Red Hat Directory Server (Simo Sorce)- patch to avoid depending on to define NI_MAXHOST and NI_MAXSERV- enable patch for key-expiration reporting - enable patch to make kpasswd fall back to TCP if UDP fails (#251206) - enable patch to make kpasswd use the right sequence number on retransmit - enable patch to allow mech-specific creds delegated under spnego to be found when searching for creds- some init script cleanups - drop unquoted check and silent exit for "$NETWORKING" (#426852, #242502) - krb524: don't barf on missing database if it looks like we're using kldap, same as for kadmin - return non-zero status for missing files which cause startup to fail (#242502)- allocate space for the nul-terminator in the local pathname when looking up a file context, and properly free a previous context (Jose Plans, #426085)- rebuild- update to 1.6.3, dropping now-integrated patches for CVE-2007-3999 and CVE-2007-4000 (the new pkinit module is built conditionally and goes into the -pkinit-openssl package, at least for now, to make a buildreq loop with openssl avoidable)- make proper use of pam_loginuid and pam_selinux in rshd and ftpd- make krb5.conf %verify(not md5 size mtime) in addition to %config(noreplace), like /etc/nsswitch.conf (#329811)- apply the fix for CVE-2007-4000 instead of the experimental patch for setting ok-as-delegate flags- move the db2 kdb plugin from -server to -libs, because a multilib libkdb might need it- also perform PAM session and credential management when ftpd accepts a client using strong authentication, missed earlier - also label kadmind log files and files created by the db2 plugin- incorporate updated fix for CVE-2007-3999 (CVE-2007-4743) - fix incorrect call to "test" in the kadmin init script (#252322,#287291)- incorporate fixes for MITKRB5-SA-2007-006 (CVE-2007-3999, CVE-2007-4000)- cover more cases in labeling files on creation - add missing gawk build dependency- rebuild- kdc.conf: default to listening for TCP clients, too (#248415)- update to 1.6.2 - add "buildrequires: texinfo-tex" to get texi2pdf- incorporate fixes for MITKRB5-SA-2007-004 (CVE-2007-2442,CVE-2007-2443) and MITKRB5-SA-2007-005 (CVE-2007-2798)- reintroduce missing %postun for the non-split_workstation case- rebuild- rebuild- add missing pam-devel build requirement, force selinux-or-fail build- rebuild- label all files at creation-time according to the SELinux policy (#228157)- perform PAM account / session management in krshd (#182195,#195922) - perform PAM authentication and account / session management in ftpd - perform PAM authentication, account / session management, and password- xȔ`hX2L05$l5? ? hd+1 = l $ ( , 4    8(89 :UGHIXY\] ^Hbd 8e =f @l Bt \u dv l   " d x |      g h Ccpanel-perl-542-lexical-sealrequirehints0.0121.cp130~el8CPAN module - prevent leakage of lexical hintsCpanel build perl module 'Lexical::SealRequireHints'prevent leakage of lexical hintsh~Jbh-centos-8.dev.cpanel.net`perlcpanel/perlhttps://metacpan.orglinuxx86_64@b ($$h~Eh~F94fe5243eeda44bfdce38249f602bfdcfee26b638fc0c32d26c0a86aa1a754f11ba3598db150e30c47ff4c921341b521c7fba35665382304b5a705a81bb4acb7rootrootrootrootcpanel-perl-542-lexical-sealrequirehints-0.012-1.cp130~el8.src.rpmcpanel-perl(Lexical::SealRequireHints)cpanel-perl(MyModuleBuilder)cpanel-perl-542-lexical-sealrequirehintscpanel-perl-542-lexical-sealrequirehints(x86-64)cpanel-perl-542-mymodulebuildercpanel-perl-lexical-sealrequirehintscpanel-perl-mymodulebuilder     cpanel-perl-542rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h@b@`-@YW@V<@S>Todd Rinaldo - 0.012-1.cp130Busy Camels - 0.011-1.cp108Busy Camels - 0.011-1.cp1198Todd Rinaldo - 0.011-1.cp1170Todd Rinaldo - 0.010-1.cp1162Todd Rinaldo - 0.009-1.cp1156Todd Rinaldo - 0.007-1.cp1146- Update from upstream: Lexical-SealRequireHints 0.012- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Lexical-SealRequireHints 0.011- Update from upstream: Lexical-SealRequireHints 0.010- Update from upstream: Lexical-SealRequireHints 0.009- Update from upstream: Lexical-SealRequireHints 0.0070.01200.012-1.cp130~el80.012-1.cp130~el800.0120SealRequireHints.pmSealRequireHints.so/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/x86_64-linux/Lexical//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/x86_64-linux/auto/Lexical/SealRequireHints/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuPerl5 module source textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=72e9a508c27c7ad35ba2e0fbfc5f264f39757409, not strippedutf-86472d1272aac5265b2af65a7a71b45cfd641e47d2c2e1a6a6c26767a9d76b1e4?-IJXa6}25cd38a242cd2b2aeec80d81c74641ac4ddc4e6a02593861915eca8e48ed52f67fbad7a785852cf857cebc3ede2fa673773a2319j{bj{Ux8WX_Lzo$onpf77db5d882df048fad8708efe231127d05853ffd94d5a4eb6dd2954362d5691b0e7feb366b7da739cb620baddf6814ac2524e32a83d03023b2df51951fb2dd68c5463929a74e37714ea2c186d05d87c2f2f6b662a28ed6c210d906a56824e6a21965b9950a03e79545996194133995e093b1ed78ab4c69c1970697db3a9a0ae97c17ac19540992c9cba6837d9d7b39bd663bedafa420fa39e0469732870ff036d04084bad013d2adc9622b2b55a503fa825f4a376e561a3ade9e0c4ae6db18ac5e5d86ef59a4c0c971729c0ef4e9a33cb5e9cc5adbb362cf67c4515025b15c0925f8d58e57c806ba3317cbc88e1f0454dd256f7f173323f135bb30e76f194a68d4653929c2e917b06c97471b07b4fdcbb33f802087c6f99ba7edefa1e4dabeed3ddc609a84338de7ea7e24a183823ea587a51b6c365fe106968b8179196af64f062440368a10c41fd5c0b43c64115c64c72be46f50fcfcfa02365c78b4133cac53e51eb40f7619912138f3d13f2b1d98e72b17c057a82511399a959731226c9dcb83c0414b7251c78e7b5b737995543125edc18803811ad5b0683f00a4fab896339d25df73c6f7abd2897a7fef2176525d33f5caa962422099463e2e142e1a0d15252c34b73ae87296257d3a459aa745eeb3360174d2dc19593051a68f44e9a06999c5b9f02a8a408d4d7d3b368a628cc1b1167e21a4aa611f1dbabbfaca24d5ad42e900105c1c711019628a681cdb87765df7c982e082ef7a8a06c10af14ac8f518e540e733cb61bb9ebdd31b849ab104b22b85f2e333a3f8adac6331bc7e9a89b66196fd324cb85a34b25dbd89fbb5fa91160bcaa68d9d2b756d4f69c4a3dbc04600a6ab4dd4c263a01311955d0651d9a8faa26bc52b84397e886214b23cf6ae85f5eeb9ab895a9f1546f44b7391b96affb7bc92c5359d304b89dec3140865a36d020c6a6eb0cf614cd0e54e0a58d2b1a387354c54d069789fad3df31c50d5e1fca56f0828730437067488dbd9be83b0b94d7bbb27243d8a100012569658c8c8f04ab553d3af92d8e2dcaf00d1f169c114c5cbba60a677abd6ee0f1d4de54b41d6f39691d7398bb0bfeb104f83f31af6e4142b9b642f53f7e91076bd1ac2b21df739363aa8ecbb9927bd88bef2dad449f09aff5cdc9eaae3ee51da1536ab664a06b56872165c36521055e40d1af5258e7cd20a5e69bdfbf02d2b5af2ae5219cba77a8e402b9711e0a2b99a0bb5e5a01b35c5a836010f11aed518b2f138d752003efe7c97f38f26bccfa4c11d7dd6f1a9421a555757fc0ac4776a81f7661f8e1695bbd10cadc60d5130218a3504bdbf86969cfcce1f4062df6b94cb4aa6108820b223a6fff0698fe84e0d7394d619fad1021f9a7d33fcd2ae94e2d29411d2bc0f17a437b607c9999f50343647637ab635e9325beb19c6ec233e8ee648229a063db4937f43dc9072768eb8233b0067544378331d0f3c2d524f1d7b12e85a438a1d8a86e1b78c76572801970c05fe1633222acdadee8aefbe60fc2192208ecc67c0e4f7cf7a49381ecf616530e5ff6247a098eb7cf25ee26e9f55fa6e4e42de62e4d9828ebb20f5f30ff56c0e897c36129726ba7496e88af06df862f7d023ecfc0a66ef58dca4d22b689a57edc0e9a1d9e65e00eeaafa8ea273c1cfd411222bff39d80e927c7eca600e3d7d30665c09edbf47ad5a0b5fb4b68ef176c52818a2beb964b92054ee1b176f0cba830b76db0cf1b2e07609e7eac582bfaa21fea8ba2879db3aad98f50f55f430c6de192af8873df8ccfd39da43443b4208059dd01ef47d842efb3ce2a4bc3859812bcc01168be07c40a44ec17600e6eb2f6d41144fcfccadnf-3rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootdnf-4.7.0-21.el8_10.alma.1.src.rpmdnfdnf-command(alias)dnf-command(autoremove)dnf-command(check-update)dnf-command(clean)dnf-command(distro-sync)dnf-command(downgrade)xGX;L0 $ 78-21Dan Walsh 2.0.78-20Dan Walsh 2.0.78-19Dan Walsh 2.0.78-17Dan Walsh 2.0.78-16Dan Walsh 2.0.78-15Dan Walsh 2.0.78-14Dan Walsh 2.0.78-13Dan Walsh 2.0.78-12Dan Walsh 2.0.78-11Dan Walsh 2.0.78-10Dan Walsh 2.0.78-9Dan Walsh 2.0.78-8Dan Walsh 2.0.78-7Dan Walsh 2.0.78-6Dan Walsh 2.0.78-5Dan Walsh 2.0.78-4Dan Walsh 2.0.78-3Dan Walsh 2.0.78-2Dan Walsh 2.0.78-1Dan Walsh 2.0.77-1Dan Walsh 2.0.76-1Dan Walsh 2.0.75-3Dan Walsh 2.0.75-2Dan Walsh 2.0.75-1Dan Walsh 2.0.74-15Dan Walsh 2.0.74-14Dan Walsh 2.0.74-13Dan Walsh 2.0.74-12Dan Walsh 2.0.74-11Dan Walsh 2.0.74-10Dan Walsh 2.0.74-9Dan Walsh 2.0.74-8Dan Walsh 2.0.74-7Dan Walsh 2.0.74-6Dan Walsh 2.0.74-5Dan Walsh 2.0.74-4Dan Walsh 2.0.74-3Dan Walsh 2.0.74-2Dan Walsh 2.0.74-1Dan Walsh 2.0.73-5Dan Walsh 2.0.73-4Dan Walsh 2.0.73-3Dan Walsh 2.0.73-2Dan Walsh 2.0.73-1Dan Walsh 2.0.71-15Bill Nottingham 2.0.71-15Dan Walsh 2.0.71-14Tomas Mraz - 2.0.71-13Dan Walsh 2.0.71-12Dan Walsh 2.0.71-11Dan Walsh 2.0.71-10Ville Skyttä - 2.0.71-9Dan Walsh 2.0.71-7Dan Walsh 2.0.71-6Dan Walsh 2.0.71-5Dan Walsh 2.0.71-4Dan Walsh 2.0.71-3Dan Walsh 2.0.71-2Dan Walsh 2.0.71-1Dan Walsh 2.0.70-2Dan Walsh 2.0.70-1Dan Walsh 2.0.68-1Fedora Release Engineering - 2.0.64-3Tom "spot" Callaway 2.0.64-2Dan Walsh 2.0.64-1Dan Walsh 2.0.63-5Dan Walsh 2.0.63-4Dan Walsh 2.0.63-3Dan Walsh 2.0.63-2Dan Walsh 2.0.63-1Dan Walsh 2.0.62-14Dan Walsh 2.0.62-13Dan Walsh 2.0.62-12Dan Walsh 2.0.62-10Dan Walsh 2.0.62-9Dan Walsh 2.0.62-8Dan Walsh 2.0.62-7Dan Walsh 2.0.62-6Dan Walsh 2.0.62-5Dan Walsh 2.0.62-4Fedora Release Engineering - 2.0.62-3Dan Walsh 2.0.62-2Dan Walsh 2.0.62-1Dan Walsh 2.0.61-10Dan Walsh 2.0.61-9Dan Walsh 2.0.61-8Dan Walsh 2.0.61-7Dan Walsh 2.0.61-6Dan Walsh 2.0.61-4Dan Walsh 2.0.61-3Dan Walsh 2.0.61-2Dan Walsh 2.0.61-1Dan Walsh 2.0.60-7Dan Walsh 2.0.60-6Dan Walsh 2.0.60-5Dan Walsh 2.0.60-4Ignacio Vazquez-Abrams - 2.0.60-3Dan Walsh 2.0.60-2Dan Walsh 2.0.60-1Ignacio Vazquez-Abrams - 2.0.x7X<LhH$1Dan Walsh 1.9.1-1Dan Walsh 1.9-19Dan Walsh 1.9-18Dan Walsh 1.9-17Dan Walsh 1.9-16Dan Walsh 1.9-15Dan Walsh 1.9-14Dan Walsh 1.9-12Dan Walsh 1.9-11Dan Walsh 1.9-10Dan Walsh 1.9-9Dan Walsh 1.9-8Dan Walsh 1.9-7Dan Walsh 1.9-6Dan Walsh 1.9-5Dan Walsh 1.9-4Dan Walsh 1.9-3Dan Walsh 1.9-2Dan Walsh 1.9-1Dan Walsh 1.6-8Dan Walsh 1.6-7Dan Walsh 1.6-6Dan Walsh 1.6-5Dan Walsh 1.6-4Dan Walsh 1.6-3Dan Walsh 1.6-2Dan Walsh 1.6-1Dan Walsh 1.4-9Elliot Lee Dan Walsh 1.4-7Dan Walsh 1.4-6Dan Walsh 1.4-5Dan Walsh 1.4-4Dan Walsh 1.4-3Dan Walsh 1.4-2Dan Walsh 1.4-1Dan Walsh 1.2-9Dan Walsh 1.2-8Dan Walsh 1.2-7Dan Walsh 1.2-6Dan Walsh 1.2-5Dan Walsh 1.2-4Dan Walsh 1.2-3Dan Walsh 1.2-1Dan Walsh 1.1-4Dan Walsh 1.1-3Dan Walsh 1.1-2Dan Walsh 1.0-1- python/semanage: Allow modifying records on "add" (RHEL-28167) - python/semanage: Do not sort local fcontext definitions (RHEL-24461)- Harden more tools against "rogue" modules (RHEL-17351) - sepolicy: port to dnf4 python API (RHEL-17398)- Update translations (#2124826)- python/sepolicy: Cache conditional rule queries (#2155540)- python/sepolicy: add missing booleans to man pages (#2155540)- python: Harden tools against "rogue" modules (#2128976) - Update "pathfix" arguments to match ^^^ (#2128976) - python: Do not query the local database if the fcontext is non-local (#2124825)- python: Split "semanage import" into two transactions (#2063353) - semodule: rename --rebuild-if-modules-changed to --refresh (#2089802) - selinux-autorelabel: Do not force reboot (#2093133)- semodule: move module hashing into libsemanage (requires libsemanage-2.9-7) - semodule: add command-line option to detect module changes (#2049189)- Improve error message when selabel_open fails (#1926511)- semodule: add -m | --checksum option- Update translations (#1962009)- setfiles: do not restrict checks against a binary policy (#1973754)- Update translations (#1899695)- selinux(8,5): Describe fcontext regular expressions (#1904059)- setfiles: Do not abort on labeling error (#1794518)- python/sepolgen: allow any policy statement in if(n)def (#1868717)- python/semanage: Sort imports in alphabetical order - python/semanage: empty stdout before exiting on BrokenPipeError (#1822100)- Update translations (#1754978)- restorecond: Fix redundant console log output error (#1626468)- dbus: Fix FileNotFoundError in org.selinux.relabel_on_boot (#1754873)- Configure autorelabel service to output to journal and to console if set (#1766578)- fixfiles: Fix "verify" option (#1647532) - semanage: Improve handling of "permissive" statements (#1417455) - semanage: fix moduleRecords.customized() - semanage: Add support for DCCP and SCTP protocols (#1563742)- semanage: Do not use default s0 range in "semanage login -a" (#1554360) - gui: Fix remove module in system-config-selinux (#1748763)- fixfiles: Fix unbound variable problem (#1743213)- Update transition - fixfiles: Fix [-B] [-F] onboot- SELinux userspace 2.9 release- semanage: move valid_types initialisations to class constructors - semanage: import sepolicy only wx&X=nL8E~$n~}Error as well (Igor Gnatenko) - Switch out automatic service for automatic-download and automatic-install (Pat Riehecky) - Make upgrade-to alias for upgrade (RhBug:1327999) (Jaroslav Mracek) - skip appending an empty option (RhBug: 1400081) (Michael Mraka) - Add description of nevra foems for commands and autoremove args (Jaroslav Mracek) - Add support of arguments nevra forms for autoremove command (Jaroslav Mracek) - Add nevra forms for remove command (Jaroslav Mracek) - Add nevra forms for install command (Jaroslav Mracek) - add bin/yum into .gitignore (Michal Luscon) - clean: acquire all locks before cleaning (RhBug:1293782) (Michal Luscon) - Change hawkey version requirement (Jaroslav Mracek) - Add information for translators (RhBug:1386078) (Jaroslav Mracek) - Change info to warning for clean repoquery output (RhBug:1358245) (Jaroslav Mracek) - Add description of pkg flag for Query (RhBug:1243393) (Jaroslav Mracek) - Add minor changes in documentation (Jaroslav Mracek) - Do not always overwrite the name with the repo ID (Neal Gompa)- See http://dnf.readthedocs.io/en/latest/release_notes.html- See http://dnf.readthedocs.io/en/latest/release_notes.html- Obsolete dnf-langpacks - Backport patch for dnf repolist disabled- Update to 1.1.10- Fix typo- Also change shebang for %{?system_python_abi} in %{_bindir}/dnf- Add %{?system_python_abi}- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Revert "group: treat mandatory pkgs as mandatory if strict=true" (RhBug:1337731) - enforce-api: reflect changes from #992475 in completion_helper (RhBug:1338504) - enforce-api: add compatibility methods for renamed counterparts (RhBug:1338564)- doc: release notes 1.1.9 (Igor Gnatenko) - spec: correctly set up requirements for python subpkg (Igor Gnatenko) - spec: follow new packaging guidelines & make compatible with el7 (Igor Gnatenko) - zanata update (Jan Silhan) - enforce-api: add missing bits of Base class (Michal Luscon) - help: unify help msg strings (Michal Luscon) - enforce-api: decorate Base class (Michal Luscon) - util: add decorator informing users of nonapi functions (Michal Luscon) - Added description for 'autoremove' in dnf help (RhBug:1324086) (Abhijeet Kasurde) - i18n: fixup for 0db13feed (Michal Luscon) - i18n: use fallback mode if terminal does not support UTF-8 (RhBug:1332012) (Michal Luscon) - Revert "spec: follow new packaging guidelines & make compatible with el7" (Michal Luscon) - move autoglob feature directly to filterm() and filter() (Michael Mraka) - group: treat mandatory pkgs as mandatory if strict=true (RhBug:1292892) (Michal Luscon) - locks: fix lock paths in tmpfsd config since cachedir has been changed (Michal Luscon) - remove formating from translation strings (Michal Luscon) - base: set diskspace check filter before applying the filters (RhBug:1328674) (Michal Luscon) - order repos by priority and cost (Michael Mraka) - spec: follow new packaging guidelines & make compatible with el7 (Igor Gnatenko) - bash-completion: first try to set fallback to BASH_COMPLETION_COMPATDIR (Igor Gnatenko) - updated copyrights for files changed this year (Michael Mraka) - cli: fix warning from re.split() about non-empty pattern (RhBug:1286556) (Igor Gnatenko) - update authors file (Michal Luscon) - Define __hash__ method for YumHistoryPackage (RhBug:1245121) (Max Prokhorov)- refactor: repo: add md_expired property (Michal Domonkos) - test: fix cachedir usage in LocalRepoTest (Michal Domonkos) - clean: operate on all cached repos (RhBug:1278225) (Michal Domonkos) - refactor: repo: globally define valid repoid chars (Michal Domonkos) - RepoPersistor: only write to disk when requested (Michal Domonkos) - clean: remove dead subcommands (Michal Domonkos) - doc: --best in case of problem (RhBug:1309408) (Jan Silhan) - Added fix for correct error message for group info (RhBug:1209649) (Abhijeet Kasurde) - repo: don't get current timeout for librepo (RhBug:1272977) (Igor Gnatenko) - doc: fix default timeout value (Michal Luscon) - xX>ULQT$QTT t interface instead - dropped trusted interface funcionality, use trusted zone instead - using zone, service and icmptype configuration files - not using any system-config-firewall parts anymore- new version 0.1.3 - restore all firewall features for reload: panic and virt rules and chains - string fixes for firewall-cmd man page (by Jiri Popelka) - fixed firewall-cmd port list (by Jiri Popelka) - added firewall dbus client connect check to firewall-cmd (by Jiri Popelka) - translation updates: de, es, gu, it, ja, kn, ml, nl, or, pa, pl, ru, ta, uk, zh_CN- fixed package according to package review (rhbz#665395): - non executable scripts: dropped shebang - using newer GPL license file - made /etc/dbus-1/system.d/FirewallD.conf config(noreplace) - added requires(post) and (pre) for chkconfig- new version 0.1.1 - fixed source path in POTFILES* - added missing firewall_config.py.in - added misssing space for spec_ver line - using firewall_config.VARLOGFILE - added date to logging output - also log fatal and error logs to stderr and firewall_config.VARLOGFILE - make log message for active_firewalld fatal- initial package (proof of concept implementation)0.9.11-12.el8_10.alma.1firewalldhelpersicmptypesipsetspoliciesserviceszonesmacros.firewalld/usr/lib//usr/lib/firewalld//usr/lib/rpm/macros.d/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnudirectoryASCII textutf-8761ed99ed1238fb76da8e31bde65ca4f4a24d0b4034a41c122a92631c527e432?p' 3!^P,*%je *%G%T)=-BltbokmCȝX#'ҳ0p{VSP:M0p*.$M>x[ߐ9OfGISm&A w%O٘pa߬Pv.>R2._nqbZ`*P mLp*_Tit%6$q8C U7Aʉ.CDYdױLk(~\oэJiTVJ Frϙret)G>"ţ@4DOLdsm4!I8&@hZ/d@" ߮w>f+{?Q[L"3!^P,*%je *%?W:}l@ZFs񠦮Seuǚ$'E$F6kBDEGȁs_ɠ} o>]#mLr+*5ڿj lC4-,x50Db}Csخ.rvS2u`7oRܓC?P(FA, faB*lRim hGڟ7n:pr11A2u;K)('XF%nۯҞqwDG51EPYH9|=W Wa|&,VP$tMd@ -wpOnW ,cFPozeD": h~I/@|S UH^Huq/:~Q;<`7q9ԧL*0kh6Cp?)?@7W-"2M*ZtO+\bS!YZ`V+NJ}9dc1bec2e044817dee01d0b49e11d9c05ec15f9a01aa2aefe35e0a5db4316457fb5de139ee0a64cbfa603496724b3904c1ee1c5f5jj.5.gzns rgshadowZ gsettings.locYg gsettings.its dgsettings.1.gzr)   .s gsettings/n gs_wan_e.ps-C. gs_type1.pspo-~ gs_typ42.pspo,} gs_typ32.pspo+| gs_ttf.ps*h gs_trap.psg)x gs_sym_e.ps( gs_std_e.ps'Q gs_statd.psg&n gs_setpd.psg%+ gs_resmp.psel$+ gs_res.ps# gs_pdfwr.psa"1 gs_pdf_e.psQ!g gs_mro_e.ps-6  gs_mgl_e.ps.p gs_mex_e.psct3 gs_ll3.psg gs_lev2.psythD gs_init.psgh gs_img.ps gs_il1_e.psn-Q gs_icc.psxX?L($33.6-9Dan Walsh 1.33.6-8Dan Walsh 1.33.6-7Dan Walsh 1.33.6-6Dan Walsh 1.33.6-5Jeremy Katz - 1.33.6-4Dan Walsh 1.33.6-3Dan Walsh 1.33.6-2Dan Walsh 1.33.6-1Dan Walsh 1.33.5-4Dan Walsh 1.33.5-3Dan Walsh 1.33.5-2Dan Walsh 1.33.5-1Dan Walsh 1.33.4-2Dan Walsh 1.33.4-1Dan Walsh 1.33.2-2Dan Walsh 1.33.2-1Dan Walsh 1.33.1-9Dan Walsh 1.33.1-8Dan Walsh 1.33.1-7Dan Walsh 1.33.1-6Dan Walsh 1.33.1-5Dan Walsh 1.33.1-4Dan Walsh 1.33.1-3Dan Walsh 1.33.1-2Dan Walsh 1.33.1-1Dan Walsh 1.32-3Dan Walsh 1.32-2Dan Walsh 1.32-1Dan Walsh 1.30.30-2Dan Walsh 1.30.30-1Dan Walsh 1.30.29-6Dan Walsh 1.30.29-5Dan Walsh 1.30.29-4Dan Walsh 1.30.29-3Dan Walsh 1.30.29-2Dan Walsh 1.30.29-1Dan Walsh 1.30.28-9Dan Walsh 1.30.28-8Dan Walsh 1.30.28-7Dan Walsh 1.30.28-6Dan Walsh 1.30.28-5Dan Walsh 1.30.28-4Dan Walsh 1.30.28-3Dan Walsh 1.30.28-2Dan Walsh 1.30.28-1Dan Walsh 1.30.27-5Dan Walsh 1.30.27-4Dan Walsh 1.30.27-3Dan Walsh 1.30.27-2Dan Walsh 1.30.27-1Dan Walsh 1.30.26-1Dan Walsh 1.30.25-1Dan Walsh 1.30.22-3Dan Walsh 1.30.22-2Dan Walsh 1.30.22-1Dan Walsh 1.30.17-7Dan Walsh 1.30.17-6Dan Walsh 1.30.17-5Dan Walsh 1.30.17-4Dan Walsh 1.30.17-3Dan Walsh 1.30.17-2Dan Walsh 1.30.17-1Dan Walsh 1.30.14-5Dan Walsh 1.30.14-4Dan Walsh 1.30.14-3Dan Walsh 1.30.14-2Dan Walsh 1.30.14-1James Antill 1.30.12-5Dan Walsh 1.30.12-4Dan Walsh 1.30.12-3Dan Walsh 1.30.12-2Dan Walsh 1.30.12-1Dan Walsh 1.30.11-1Dan Walsh 1.30.10-4James Antill 1.30.10-3James Antill 1.30.10-2Dan Walsh 1.30.10-1Dan Walsh 1.30.9-4James Antill 1.30.9-3James Antill 1.30.9-2Dan Walsh 1.30.9-1Dan Walsh 1.30.8-2Dan Walsh 1.30.8-1Dan Walsh 1.30.6-5Dan Walsh 1.30.6-4Dan Walsh 1.30.6-3Dan Walsh 1.30.6-2Dan Walsh 1.30.6-1Karsten Hopp 1.30.4-4Karsten Hopp 1.30.4-3Dan Walsh 1.30.4-2Dan Walsh 1.30.4-1Dan Walsh 1.30.1-4Dan Walsh 1.30.1-3Dan Walsh 1.30.1-2Dan Walsh 1.30.1-1Dan Walsh 1.30-5Dan Walsh 1.30-4Dan Walsh 1.30-3Dan Walsh 1.30-2Dan Walsh 1.30-1Dan Walsh 1.29.27-1Dan Walsh ] [] security" command. (RhBug:850912) (Radek Holy) - Add "updateinfo [] [] bugfix" command. (Radek Holy) - Add "updateinfo [] [] enhancement" command. (Radek Holy) - Add "updateinfo [] [] [...]" command. (Radek Holy) - Add "updateinfo [] [] [...]" command. (Radek Holy) - Add "updateinfo [] all" command. (Radek Holy) - Add "updateinfo [] updates" command. (Radek Holy) - Add "updateinfo [] installed" command. (Radek Holy) - Add "-v updateinfo info" command. (Radek Holy) - Add "updateinfo info" command. (Radek Holy) - Add "updateinfo list" command. (Radek Holy) - Add "updateinfo available" command. (Radek Holy) - Add "updateinfo summary" command. (Radek Holy) - Add basic updateinfo command. (Radek Holy) -xpXA LȀt$dtsu1Jitka Plesnikova - 1.835-365Fedora Release Engineering - 1.835-348Fedora Release Engineering - 1.835-347Jitka Plesnikova - 1.835-346Jitka Plesnikova - 1.835-345Jitka Plesnikova - 1.835-2Petr Pisar - 1.835-1Petr Pisar - 1.834-1Petr Pisar - 1.833-1Jitka Plesnikova - 1.831-311Jitka Plesnikova - 1.831-310Jitka Plesnikova - 1.831-7Fedora Release Engineering - 1.831-6Petr Pisar - 1.831-5Petr Pisar - 1.831-4Petr Pisar - 1.831-3Fedora Release Engineering - 1.831-2Petr Pisar - 1.831-1Petr Pisar - 1.830-1Jitka Plesnikova - 1.829-4Fedora Release Engineering - 1.829-3Petr Pisar - 1.829-2Petr Pisar - 1.829-1Petr Pisar - 1.828-1Petr Pisar 1.827-1- 1.842 bump- 1.841 bump- Add build-require gcc- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Perl 5.26 re-rebuild of bootstrapped packages- Perl 5.26 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- 1.840 bump- Perl 5.24 re-rebuild of bootstrapped packages- 1.838 bump- Increase release to favour standalone package- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 re-rebuild of bootstrapped packages- Increase release to favour standalone package- Perl 5.22 rebuild- 1.835 bump- 1.834 bump- 1.833 bump- Perl 5.20 re-rebuild of bootstrapped packages- Increase release to favour standalone package- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Build-require Test::More always because of the new thread tests- Initialize db_DESTROY return variable (bug #1107732)- Destroy DB_File objects only from original thread context (bug #1107732)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- 1.831 bump- 1.830 bump- Perl 5.18 re-rebuild of bootstrapped packages- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- 1.829 bump- 1.828 bump- Specfile autogenerated by cpanspec 1.78. 1.8421.842-1.el81.842-1.el8.build-idb1d209d818e88db0d2b548706296f552310272bfDB_File.pmDB_FileDB_File.soperl-DB_FileChangesREADMEdbinfoDB_File.3pm.gz/usr/lib//usr/lib/.build-id//usr/lib/.build-id/b1//usr/lib64/perl5/vendor_perl//usr/lib64/perl5/vendor_perl/auto//usr/lib64/perl5/vendor_perl/auto/DB_File//usr/share/doc//usr/share/doc/perl-DB_File//usr/share/man/man3/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryPerl5 module source textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b1d209d818e88db0d2b548706296f552310272bf, strippedASCII textPerl script text executabletroff or preprocessor input, ASCII text (gzip compressed data, max compression, from UnixX&iL y$iyxzslav Mracek) - Unify format of %{_mandir} paths in dnf.spec (Jaroslav Mracek) - Remove test_yumlayer.py as unneeded test (Jaroslav Mracek) - Provide yum4 package for rhel7 build (Jaroslav Mracek) - Make yum compatible layer very minimal (RhBug:1476748) (Jaroslav Mracek) - Remove metadata_expire from yum compatible layer (Jaroslav Mracek) - Remove keepcache from yum compatibility layer (Jaroslav Mracek) - Remove options from yum conf (Jaroslav Mracek) - Remove unused functionality from yum compatible layer (Jaroslav Mracek) - Add deplist command for dnf (Jaroslav Mracek) - Fix problems with --downloaddir options (RhBug:1476464) (Jaroslav Mracek) - Move description of --forcearch into proper place (Jaroslav Mracek) - Provide description of --downloaddir option (Jaroslav Mracek) - Fix if in spec file (Jaroslav Mracek) - Add description of "test" tsflags (Jaroslav Mracek) - Enable import gpg_keys with tsflag test (RhBug:1464192) (Jaroslav Mracek) - Keep old reason when undoing erase (RhBug:1463107) (Eduard Čuba) - spec: eliminate other weak dependencies for el<=7 (Igor Gnatenko) - spec: do not strongly require inhibit plugin (Igor Gnatenko) - Inform that packages are only downloaded (RhBug:1426196) (Jaroslav Mracek) - Move releasever check after the etc/dnf/vars substitutions. (Alexander Kanavin) - Provide substitution for Repodict.add_new_repo() (RhBug:1457507) (Jaroslav Mracek)- Remove autodeglob optimization (Jaroslav Rohel) - Integrate --destdir with --destdir from download plugin (Ondřej Sojka) - Add CLI option --destdir (RhBug:1279001) (Ondřej Sojka) - Add myself to the AUTHORS file (Nathaniel McCallum) - Add the --forcearch CLI flag (Nathaniel McCallum) - Add 'ignorearch' option (Nathaniel McCallum) - Provide an API for setting 'arch' and 'basearch' (Nathaniel McCallum) - Add nevra forms for repoquery command (Jaroslav Rohel) - Fix UnicodeDecodeError during checkSig() on non UTF-8 locale (RhBug:1397848) (Jaroslav Rohel) - Add dnf option --noautoremove (RhBug:1361424) (Jaroslav Mracek) - Add group argument for mark command (Jaroslav Mracek) - Report problems for each pkg during gpgcheck (RhBug:1387925) (Jaroslav Mracek) - fix minor spelling mistakes (René Genz) - Print warning when wrong delimiter in cache (RhBug:1332099) (Vítek Hoch) - Fix the loading of config for dnf-automatic command_email (RhBug:1470116) (Jaroslav Rohel) - Enable download progress bar if redirected output (RhBug:1161950) (Jaroslav Mracek) - Support short abbrevations of commands (RhBug:1320254) (Vítek Hoch) - Remove unused variables kwargs (Jaroslav Mracek) - Not reinstall packages if install from repository-pkgs used (Jaroslav Mracek) - bump dnf version to 2.6.0 (Igor Gnatenko) - spec: use python2- prefix for hawkey (Igor Gnatenko) - spec: use sphinx-build binary rather than package name (Igor Gnatenko) - spec: python-bugzilla is not needed for building (Igor Gnatenko) - spec: fix instructions about generating tarball (Igor Gnatenko) - po: Update translations (Igor Gnatenko) - Add an example of installation without weak-deps (RhBug:1424723) (Jaroslav Mracek) - Add detection if mirrorlist is used for metalink (Jaroslav Mracek) - Rename variable (Jaroslav Mracek) - Add --groupmember option to repoquery (RhBug:1462486) (Jaroslav Mracek) - Check checksum for local repositories (RhBug:1314405) (Jaroslav Mracek) - Spelling fixes (Ville Skyttä) - repoquery --obsoletes prints obsoletes (RhBug:1457368) (Matěj Cepl) - Provide pkg name hint for icase (RhBug:1339280) (RhBug:1138978) (Jaroslav Mracek) - Return only latest pkgs for "dnf list upgrades" (RhBug:1423472) (Jaroslav Mracek) - cleanup code not executed in case of exception (Marek Blaha) - Allow to modify message for user confirmation (Jaroslav Mracek) - Add autocheck_running_kernel config option (Štěpán Smetana) - Inform about skipped packages for group install (RhBug:1427365) (Jaroslav Mracek) - Remove group remove unneeded pkgs (RhBug:1398871) (RhBug:1432312) (Jaroslav Mracek) - po: update translations (Igor Gnatenko)- bump version tox`XCoL(6@$o~cli: inform only about nonzero md cache check interval (Michal Luscon) - base: report errors in batch at the end of md downloading (Michal Luscon) - repo: produce more sane error if md download fails (Michal Luscon) - zanata update (RhBug:1322226) (Jan Silhan) - doc: Fixed syntax of `assumeyes` and `defaultyes` ref lables in `conf_ref.rst` (Matt Sturgeon) - Fix output headers for dnf history command (Michael Dunphy) - doc: change example of 'dnf-command(repoquery)' (Jaroslav Mracek) - makacache.service: shorten journal logs (RhBug:1315349) (Michal Luscon) - config: improve UX of error msg (Michal Luscon) - Added user friendly message for out of range value (RhBug:1214562) (Abhijeet Kasurde) - doc: prefer repoquery to list (Jan Silhan) - history: fix empty history cmd (RhBug:1313215) (Michal Luscon) - Very minor tweak to the docs for `--assumeyes` and `--assumeno` (Matt Sturgeon)- Add `/etc/distro.repos.d` as a path owned by the dnf package (Neal Gompa (ニール・ゴンパ)) - Change order of search and add new default repodirs (RhBug:1286477) (Neal Gompa (ニール・ゴンパ)) - group: don't mark available packages as installed (RhBug:1305356) (Jan Silhan) - history: adjust demands for particular subcommands (RhBug:1258503) (Michal Luscon) - Added extension command for group list (RhBug:1283432) (Abhijeet Kasurde) - perf: dnf repository-packages upgrade (RhBug:1306304) (Jan Silhan) - sack: Pass base.conf.substitutions["arch"] to sack in build_sack() function. (Daniel Mach) - build: make python2/3 binaries at build time (Michal Domonkos) - fix dnf history traceback (RhBug:1303149) (Jan Silhan) - cli: truncate expiration msg (RhBug:1302217) (Michal Luscon)- history: don't fail if there is no history (RhBug:1291895) (Michal Luscon) - Allow dnf to use a socks5 proxy, since curl support it (RhBug:1256587) (Michael Scherer) - output: do not log rpm info twice (RhBug:1287221) (Michal Luscon) - dnf owns /var/lib/dnf dir (RhBug:1294241) (Jan Silhan) - Fix handling of repo that never expire (RhBug:1289166) (Jaroslav Mracek) - Filter out .src packages when multilib_proto=all (Jeff Smith) - Enable string for translation (RhBug:1294355) (Parag Nemade) - Let logging format messages on demand (Ville Skyttä) - clean: include metadata of local repos (RhBug:1226322) (Michal Domonkos) - completion: Install to where bash-completion.pc says (Ville Skyttä) - spec: bash completion is not a %config file (Ville Skyttä) - Change assertion handling for rpmsack.py (RhBug:1275878) (Jaroslav Mracek) - cli: fix storing arguments in history (RhBug:1239274) (Ting-Wei Lan)- base: save group persistor only after successful transaction (RhBug:1229046) (Michal Luscon) - base: do not clean tempfiles after remove transaction (RhBug:1282250) (Michal Luscon) - base: clean packages that do not belong to any trans (Michal Luscon) - upgrade: allow group upgrade via @ syntax (RhBug:1265391) (Michal Luscon) - spec: Mark license files as %license where available (Ville Skyttä) - Remove unused imports (Ville Skyttä) - Spelling fixes (Ville Skyttä) - Fix typos in documentation (Rob Cutmore) - parser: add support for braces in substitution (RhBug:1283017) (Dave Johansen) - completion_helper: Don't omit "packages" from clean completions (Ville Skyttä) - bash-completion: Avoid unnecessary python invocation per _dnf_helper (Ville Skyttä) - repo: Download drpms early (RhBug:1260421) (Ville Skyttä) - clean: Don't hardcode list of args in two places (Ville Skyttä) - cli: don't crash if y/n and sys.stdin is None (RhBug:1278382) (Adam Williamson) - sp err "environement" -> "environment" (Michael Goodwin) - Remove -OO from #!/usr/bin/python (RhBug:1230820) (Jaroslav Mracek) - cli: warn if plugins are disabled (RhBug:1280240) (Michal Luscon)- AUTHORS: updated (Jan Silhan) - query: add compatibility methods (Michal Luscon) - query: add recent, extras and autoremove methods to Query (Michal Luscon) - query: add duplicated and latest-limit queries into api (Michal Luscon) - format the email xزXDLxP$KH RRRR RRRRRR RRRRR RRRRR utf-8d2238049f6864b8afc4c6c42dd498af2f275d938cae5ba00de289a240865bf84?@` Qd~ VD.ʧK5!5^0i@3e$lwΤѷJʼo5Xg/K khϼ]F/)lsyP Dk&tyx-C|* sˈ?G왼baCBs6j3i$Ôza.tZגF?, .z&<8[h^! YLhzLv4{L͐s`it &5@Ғ@ƚj>Ko)v9t>*3u^u=Dp=TKjgJ=y$\߮.Tϡ$6{c26lcL9ϭ5*K:\@Tۂb` Qd~< _u7ut0"Ql-;^Dz?0 ܵs(lK.[|IˤQqA5t~8\Y<$$xצn&>P#Mdt;d~3*m2=-kR~!c/I݁e.#5 :|pe @x:pS|RtP?g+QEpuHy*e$5'4YxbP礒u3 ֺ/Z]-`qw<{6(@(n5\l,^أ@!Jy@MM;Ɉ+-J6qRf!{ŷb1;LBأZz%߽V~u\ aea1ee11379286fcb0cd95d68cc9fd113c17c0caf49dca231c347280f22cc0383ed51f7a81157818daa96cd36d4f3bdf24fb819bj{~ 4j{~Holidays_Italy.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place. if [ x$1 = x0 ]; then echo pear.php.net/Date_Holidays_Italy >> /var/cpanel/.pending_pear_deregistrations ; fi AAA큤AA큤IHci}ci}ci}ci}ci}ci}ci}8078cc4ecc5f48e2a80b92694d5a25e8cee6ca92a040cea04e0c169af4d4543944f1bffa8fbec05749a6b580aa4ec3541d0b191cda6bd0ef326ced13e25fa7ede3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php81-date-holidays-italy-0.1.1-1.cp110~el7.src.rpmcpanel-php81-date-holidays-italy     /bin/sh/bin/shcpanel-php81cpanel-php81cpanel-php81cpanel-php81-date-holidaysrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.11.1c_a`OL@[DQMB. McMahon - 0.1.1-1.cp110~el7B. McMahon - 0.1.1-1.cp11102Nicolas Rochelemagne - 0.1.1-1.cp1198Julian Brown - 0.1.1-1.cp1176Nicolas Rochelemagne - 0.1.1-1.cp1142- Packaging for PHP v8.1- Packaging for PHP v7.4- Rename package and add Ubuntu support- Updated to PHP 7.2.create first rpm version/bin/sh/bin/shcpanel-php74-date-holidays-italy0.1.1-1.cp110~el7Date_Holidays_Italy.xmlDateHolidaysDriverItaly.phpdocscpanel-php81-date-holidays-italy-0.1.1nodocs/usr/local/cpanel/3rdparty/php/81/lib/pear//usr/local/cpanel/3rdparty/php/81/lib/php//usr/local/cpanel/3rdparty/php/81/lib/php/Date//usr/local/cpanel/3rdparty/php/81/lib/php/Date/Holidays//usr/local/cpanel/3rdparty/php/81/lib/php/Date/Holidays/Driver//usr/share/doc//usr/share/doc/cpanel-php81-date-holidays-italy-0.1.1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuXML document textdirectoryC++ source, ASCII textemptyxPXEL+$O ? ? d $ Y GMTd l t   $(89:+GHIXY\],^Vbdefltu v  , 0  @ i   g h Ccpanel-qrcodejs0.0.11.cp130~el8qrcode.js - a javascript library for making QR CodesQRCode.js is javascript library for making QRCode. QRCode.js supports Cross-browser with HTML5 Canvas and table tag in DOM. QRCode.js has no dependencies.h6.bh-centos-8.dev.cpanel.netלMITJShttps://github.com/davidshimjs/qrcodejslinuxnoarchJMׁh6.h6.h6.h6.aaa1f349028a59432eb00222b8ddfe4d2ccebdce04cf8348dcb8d41b7068107bbf7788243afc70b89b8b150922a3b85d6dab2465131a7fcffa948ecea6393c833ee72de9f69c668f9567363a9358df955960bae9000d9ebd66414670f88e8735c541ef06327885a8415bca8df6071e14189b4855336def4f36db54bde8484f36rootrootrootrootrootrootrootrootcpanel-qrcodejs-0.0.1-1.cp130~el8.src.rpmcpanel-qrcodejs     rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h5@bL@`!']µV@Thomas "Andy" Baugh - 0.0.1-1.cp130~el8Nicolas Rochelemagne - 0.0.1-1.cp108Nicolas Rochelemagne - 0.0.1-1.cp1198Nicolas Rochelemagne - 0.0.1-1.cp1186jroyer - 0.0.1-1.cp1154- Rebuild for 130 with RedHat 10 and Ubuntu 24 support.- Rebuild for 108 with RedHat 9 and Ubuntu 22 support.- Add Ubuntu support- Add CentOS 8 support- first public release0.0.1-1.cp130~el8LICENSEREADME.mdqrcode.jsqrcode.min.js/usr/local/cpanel/3rdparty/share/qrcodejs/0.0.1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuASCII text, with very long linesHTML document, ASCII textHTML document, UTF-8 Unicode text, with very long linesASCII text, with very long lines, with no line terminatorsutf-8fce3d4ac54a117064763fa677daf2d66b3088d6a69688d8d5a048b3ef7f67533?E6fDÈJU82bd9453c842ad54d39dfff02109b8d6d8b66a508ed0e982e41b05f0fc8a06a74350effae9d4bee984a8fbe33c88419cdabee7796j{j{Uj1,j1,j1,j1,j1,j1,j1,j1,j1,j1,j1(j1'j1'j1j1'j1j1'j1)[,uj1j1j1a0f61d32a5ce7c06be11c5c0f1b36d2ea71a94cb268bc978ff7a455ec850de777871eda5d06d56e1e22db9bddb20173cd8c9ddfd145ddbf8d367f18d7ca539b14bca0f9184a74e04d70453659fba2a14024efd499ff8de7ecf7c823eea337aa63f7d83955ddb4d26d7dca1b935d76e9faad012dfd5a2da8b3cb262f91e22ba4eeccab06cba5bf8eaf7cd6a55ba474ceddf2d3468ecea89b35efcadaef31cd024dc626520dcd53a22f727af3ee42c770e56c97a64fe3adb063799d8ab032fe551b2f995e61359cb0efbfb6b3356fxȑXF~L$o in Base.group_install(). (Ales Kozumplik)- api: drop items deprecated since 0.4.9 or earlier. (Ales Kozumplik) - api: deprecate Base.select_group() (Ales Kozumplik) - doc: document the group marking operations. (Ales Kozumplik) - api: add Base.group_install() with exclude capability. (Ales Kozumplik) - groups: recognize 'mark install' instead of 'mark-install'. (Ales Kozumplik) - Allow installing optional packages from a group. (RhBug:1067136) (Ales Kozumplik) - groups: add installing groups the object marking style. (Ales Kozumplik) - groups: add Base.group_remove(). (Ales Kozumplik) - groups: add support for marking/unmarking groups. (Ales Kozumplik) - groups: add dnf.persistor.GroupPersistor(), to store the installed groups. (Ales Kozumplik) - logging: log plugin import tracebacks on the subdebug level. (Ales Kozumplik) - rename: dnf.persistor.Persistor -> RepoPersistor. (Ales Kozumplik) - doc: update README and FAQ with the unabbreviated name. (Ales Kozumplik) - groups: fix grouplist crashes with new libcomps. (Ales Kozumplik) - Do not terminate for unreadable repository config. (RhBug:1071212) (Ales Kozumplik) - cli: get rid of ridiculous slashes and the file:// scheme on config read fails. (Ales Kozumplik) - repo: log more than nothing about a remote repo MD download. (Ales Kozumplik) - drpm: fallback to .rpm download on drpm rebuild error. (RhBug:1071501) (Ales Kozumplik) - remove: Base.download_packages()' inner function mediasort(). (Ales Kozumplik) - tests: tidy up the imports, in particular import mock from support. (Ales Kozumplik) - changed documentation of distro-sync command (Jan Silhan) - added distro-sync explicit packages support (RhBug:963710) (Jan Silhan) - renamed testcase to distro_sync_all (Jan Silhan) - Minor spelling (Arjun Temurnikar) - i18n: translate repo sync error message. (Ales Kozumplik) - add support for ppc64le (Dennis Gilmore) - there is no arch called arm64 it is aarch64 (Dennis Gilmore)- doc: in the faq, warn users who might install rawhide packages on stable. (RhBug:1071677) (Ales Kozumplik) - cli: better format the download errors report. (Ales Kozumplik) - drpm: properly report applydeltarpm errors. (RhBug:1071501) (Ales Kozumplik) - fixed Japanese translatated message (RhBug:1071455) (Jan Silhan) - generated and synchronized translations with transifex (Jan Silhan) - added transifex support to cmake (gettext-export, gettext-update) (Jan Silhan) - api: expose RepoDict.get_matching() and RepoDict.all() (RhBug:1071323) (Ales Kozumplik) - api: add Repo.set_progress_bar() to the API. (Ales Kozumplik) - tests: test_cli_progress uses StringIO to check the output. (Ales Kozumplik) - downloads: fix counting past 100% on mirror failures (RhBug:1070598) (Ales Kozumplik) - repo: log callback calls to librepo. (Ales Kozumplik) - Add repository-packages remove-or-reinstall command. (Radek Holy) - Support negative filtering by new repository name in Base.reinstall. (Radek Holy) - Support removal N/A packages in Base.reinstall. (Radek Holy) - Add repository-packages remove command. (Radek Holy) - refactor: Reduce amount of code in repository-packages subcommands. (Radek Holy) - Support filtering by repository name in Base.remove. (Radek Holy) - remove: BaseCli.erasePkgs (Radek Holy) - Add repository-packages reinstall command. (Radek Holy) - exceptions: improve empty key handling in DownloadError.__str__(). (Ales Kozumplik) - downloads: fix fatal error message return value from download_payloads() (RhBug:1071518) (Ales Kozumplik) - fixes problem with TypeError in Base.read_comps() in python3 (RhBug:1070710) (Tim Lauridsen) - fix read_comps: not throwing exceptions when repo has no repodata (RhBug:1059704) (Jan Silhan) - not decompressing groups when --cacheonly option is set (RhBug:1058224) (Jan Silhan) - added forgotten import (Jan Silhan) - Add repository-packages move-to command. (Radek Holy) - Add repository-packages reinstall-old command. (Radek Holy) - Support filtering by repository name in Base.reinstall. (Radek Holy) - tests: test effects instead of mock calx0XGkL@{$k{z|or get_best_query() (Jaroslav Mracek) - Fix "Package" text translation (RhBug:1302935) (Jaroslav Rohel) - Create a warning if releasever is None (Jaroslav Mracek) - Adds cost, excludepkgs, and includepkgs to Doc (RhBug:1248684) (Jaroslav Mracek) - Change auto-detection of releasever in empty installroot (Jaroslav Mracek) - Do not load system repo for makecache command (RhBug:1441636) (Jaroslav Mracek) - Do not raise assertion if group inst and rmv pkgs (RhBug:1438438) (Jaroslav Mracek) - yum layer using python3 (Martin Hatina) - Filter url protocols for baseurl in Package.remote_location (Jaroslav Mracek) - Add armv5tl to arm basearch (Neal Gompa) - Setup additional parameters for handler for remote packages (Jaroslav Mracek) - Use same method for user/password setting of every librepo.handle (Jaroslav Mracek) - Fix PEP8 violations and remove unused import (Jaroslav Mracek) - Handle unknown file size in download progress (Jaroslav Mracek) - Allow to delete cashed files from command line by clean command (Jaroslav Mracek) - Save command line packages into chachedir (RhBug:1256313) (Jaroslav Mracek) - Add progress bar for download of commandline pkgs (RhBug:1161950) (Jaroslav Mracek) - Fix minor typo Closes: #781 Approved by: ignatenkobrain (Yuri Chornoivan) - Mark unremoved packages as failed (RhBug:1421244) (Jaroslav Mracek)- update release notes (Jaroslav Mracek) - po: Update translations (Igor Gnatenko) - Add require of subcommand for repo-pkgs command (Jaroslav Rohel) - shell: Fix commands initialization (Jaroslav Rohel) - po: Update translations (Igor Gnatenko) - Add support for --location for repoquery command (RhBug:1290137) (Jaroslav Mracek) - Add support of --recursive with --resolve in repoquery (Jaroslav Mracek) - Add --recursive option for repoquery (Jaroslav Mracek) - Add --whatconflicts for repoquery (Jaroslav Mracek) - Add support for multiple options for repoquery (Jaroslav Mracek) - Add multiple format option for repoquery (Jaroslav Mracek) - Fix problem with "dnf repoquery --querytags" (Jaroslav Mracek) - Add support of 3 options into updateinfo command (Jaroslav Mracek) - Add inheritance of reason for obsoleting packages (Jaroslav Mracek) - Mark installonlypkgs correctly as user installed (RhBug:1349314) (Jaroslav Mracek) - Solve a problem with None names in callbacks (Jaroslav Mracek) - Solve a problem for callbacks (Jaroslav Mracek) - Revert "remove: CLI: --randomwait" (RhBug:1247122) (Ondřej Sojka) - po: update translations (Igor Gnatenko) - po: update translations (Igor Gnatenko) - Set strings for translations (RhBug:1298717) (Jaroslav Mracek)- bump version to 2.2.0 + update release notes (Jaroslav Mracek) - Add documentation of new API callback actions (RhBug:1411432) (Jaroslav Mracek) - Fix python2 doesn't have e.__traceback__ attribute (Jaroslav Mracek) - Do not report erasing package as None. (Jaroslav Mracek) - Display scriplet for transaction (RhBug:1411423) (RhBug:1406130) (Jaroslav Mracek) - Add support for rpmcallbacks (Jaroslav Mracek) - AUTHORS: updated (Jaroslav Rohel) - Not show expiration check if no repo enabled (RhBug:1369212) (Jaroslav Mracek) - Fix changelog in dnf spec file (Jaroslav Mracek) - po: update translations (Igor Gnatenko) - Add myself (mhatina) to AUTHORS (Martin Hatina) - po: Update translations (Igor Gnatenko)- bump version to 2.1.1 + update release notes (Jaroslav Mracek) - Sync the translation with locale (Jaroslav Rohel) - Disable exceptions in logging (Jaroslav Rohel) - Fix severity info in "updateinfo info" (Jaroslav Mracek) - Add help for shell commands (Jaroslav Rohel) - shell: no crash if missing args (Jaroslav Rohel) - proper check of releasever, when using installroot (RhBug:1417542) (Martin Hatina) - Inform about "Cache was expired" with "dnf clean" (RhBug:1401446) (Jaroslav Mracek) - crypto: port to the official gpgme bindings (Igor Gnatenko) - Fix doc example for `fill_sack` method (Lubomír Sedlář) - po: update translations (Igor Gnatenko) - Not try to install src package (RhBug:1416699) (JaroslavxpXHL9$&999n@redhat.com>Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Bill Nottingham Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai - Fix NegoEx parsing vulnerabilities (CVE-2026-40355, CVE-2026-40356) Resolves: RHEL-171589 RHEL-171594- krad: packet ID fetched from uninitialized variable Resolves: RHEL-109220 - Improving kerberos ulog resize efficiency Resolves: RHEL-93333- Do not block HMAC-MD4/5 in FIPS mode Resolves: RHEL-86786 - Don't issue RC4 session keys by default (CVE-2025-3576) Resolves: RHEL-88049 - Add PKINIT paChecksum2 from MS-PKCA v20230920 Resolves: RHEL-82648- Prevent overflow when calculating ulog block size (CVE-2025-24528) Resolves: RHEL-78248 - kdb5_util: fix DB entry flags on modification Resolves: RHEL-56060- libkrad: implement support for Message-Authenticator (CVE-2024-3596) Resolves: RHEL-50253 - Remove RSA protocol for PKINIT Resolves: RHEL-17616- CVE-2024-37370 CVE-2024-37371 Fix vulnerabilities in GSS message token handling Resolves: RHEL-45398 RHEL-45386- Fix leak of default credentials in gss_inquire_cred() Resolves: RHEL-32258- Fix memory leak in GSSAPI interface Resolves: RHEL-27250 - Fix memory leak in PMAP RPC interface Resolves: RHEL-27244 - Make TCP waiting time configurable Resolves: RHEL-17131- Allow to make AD-SIGNEDPATH optional Resolves: RHEL-10514- Bump release number- Remove downloadable source signature file - Resolves: rhbz#2219654- Support PAC with KDC extended signature and without ticket signature - Resolves: rhbz#2169477- Fix integer overflows in PAC parsing (CVE-2022-42898) - Resolves: rhbz#2140968- Backport fix of memory use after free during libkrad cleanup - Backport support for larger RADIUS attributes in libkrad - Resolves: rhbz#2103125- Try harder to avoid password change replay errors - Resolves: #2077563- Fix kprop for propagating dump files larger than 4GB - Resolves: #2026462- Backport usage of SHA-256 instead of SHA-1 for PKINIT CMS digest - Resolves: #2066316- Fix KDC null deref on TGS inner body null server (CVE-2021-37750) - Resolves: #1997601- Fix KDC null deref on bad encrypted challenge (CVE-2021-36222) - Resolves: #1983729- Backport KCM performance enablements - Resolves: #1956388- Add APIs for marshalling credentials - Resolves: #1964619- Update tmpfiles dropin to use /run instead of /var/run - Resolves: #1945679- Add support for start_realm cache config - Resolves: #1901195- Add recursion limit for ASN.1 indefinite lengths (CVE-2020-28196) - Resolves: #1906492- Document -k option in kvno(1) synopsis - Resolves: #1869055- Enable MD5 override for FIPS RADIUS - Resolves: #1872689- Unify kvno option documentation - Resolves: #1869055- Fix upstream URLs in spec file - Resolves: #1868039- Fix leak in KERB_AP_OPTIONS_CBT server support - Resolves: #1860831- Ignore bad enctypes in krb5_string_to_keysalts() - Resolves: #1858322- Match Heimdal behavior for channel bindings - Code hygiene + test stability fix included - Resolves: #1840518- Drop DES3 from sample kdc.conf - Resolves: #x `XIL>$.>=?rting malformed UTF-8 character (RT#131646) - Fix File::Glob rt131211.t test random failures - Fix t/op/hash.t test random failures - Parse caret variables with subscripts as normal variables inside ${...} escaping (RT#131664) - Do not display too many bytes when reporting malformed UTF-8 character - Fix select called with a repeated magical variable (RT#131645) - Fix error message for "our sub foo::bar" (RT#131679) - Fix executing arybase::_tie_it() in Safe compartement (RT#131588) - Fix handling attribute specification on our variables (RT#131597) - Fix splitting non-ASCII strings if unicode_strings feature is enabled (RT#130907) - Fix compiler warnings in code generated by ExtUtils::Constant (CPAN RT#63832, CPAN RT#101487) - Fix GCC version detection for -D_FORTIFY_SOURCE override (RT#131809)- Enable separate debuginfo back- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- perl package installs all core modules, interpreter moved to perl-interpreter package, perl-core package is obsolete (bug #1464903)- Make File::Glob more resistant against degenerative matching (RT#131211) - Fix a crash when calling a subroutine from a stash (RT#131085) - Fix an improper cast of a negative integer to an unsigned 8-bit type (RT#131190) - Fix cloning :via handles on thread creation (RT#131221) - Fix glob UTF-8 flag on a glob reassignment (RT#131263) - Fix a buffer overflow in my_atof2() (RT#131526) - Fix handling backslashes in PATH environment variable when executing "perl -S" (RT#129183) - Fix a conditional jump on uninitilized memory in re_intuit_start() (RT#131575) - Fix spurious "Assuming NOT a POSIX class" warning (RT#131522) - Provide perl-interpreter RPM dependency symbol - Stop providing old perl(MODULE_COMPAT_5.24.*)- 5.26.0 bump (see for release notes) - Update sub-packages - Update or remove patches - Enable hardening (bug #1238804) - Use 64 bit ints on 32 bit platforms (bug #1268828)- Introduce build-conditions for groff, systemtap, syslog tests, and tcsh- Fix a null-pointer dereference on malformed code (RT#130815) - Fix an use-after-free in substr() that modifies a magic variable (RT#129340) - Fix a memory leak leak in Perl_reg_named_buff_fetch() (RT#130822) - Fix an invalid memory read when parsing a loop variable (RT#130814) - Fix a heap-use-after-free in four-arguments substr call (RT#130624)- Adapt Compress::Raw::Zlib to zlib-1.2.11 (bug #1420326) - Fix a heap buffer overflow when evaluating regexps with embedded code blocks from more than one source (RT#129881) - Fix a memory leak in list assignment from or to magic values (RT#130766)- Adapt tests to zlib-1.2.11 (bug #1420326) - Fix a crash when compiling a regexp with impossible quantifiers (RT#130561) - Fix a buffer overrun with format and "use bytes" (RT#130703) - Fix a buffer overflow when studying some regexps repeatedly (RT#129281, RT#129061)- Fix UTF-8 string handling in & operator (RT#129287) - Fix recreation of *:: (RT#129869) - Fix a memory leak in B::RHE->HASH method (RT#130504) - Fix parsing goto statements in multicalled subroutine (RT#113938) - Fix a heap overlow in parsing $# (RT#129274)- Fix a buffer overflow in split in scalar context (RT#130262) - Fix a heap overflow with pack "W" (RT129149) - Fix a use-after-free when processing scalar variables in forms (RT#129125) - Fix a heap overflow if invalid octal or hexadecimal number is used in transliteration expression (RT#129342) - Fix out-of-bound read in case of unmatched regexp backreference (RT#129377)- 5.24.1 bump (see for release notes)- Rebuild for readline 7.x- Remove bundled Math-BigInt-FastCalc (bug #1408463) - Remove bundled Math-BigRat (bug #1408467) - Remove bundled bignum (bug #1409585)- Fix a crash in optimized evaluation of "or ((0) xOXJLH`$-hidden sepol_module_package type. * Merged newrole and run_init pam config patches from Dan Walsh (Red Hat). * Merged fixfiles patch from Dan Walsh (Red Hat). * Updated semodule for removal of semanage_strerror.- Fix run_init.pamd and spec file- Update to match NSA * Updated semodule_link and semodule_expand to use shared libsepol. Fixed audit2why to call policydb_init prior to policydb_read (still uses the static libsepol).- Update to match NSA * Updated for changes to libsepol. Changed semodule and semodule_package to use the shared libsepol. Disabled build of semodule_link and semodule_expand for now. Updated audit2why for relocated policydb internal headers, still needs to be converted to a shared lib interface.- Update newrole pam file to remove pam-stack - Update run_init pam file to remove pam-stack- Update to match NSA * Fixed warnings in load_policy. * Rewrote load_policy to use the new selinux_mkload_policy() interface provided by libselinux.- Rebuild with newer libararies- Update to match NSA * Merged patch to update semodule to the new libsemanage API and improve the user interface from Karl MacMillan (Tresys). * Modified semodule for the create/connect API split.- More fixes to stop find from following nfs paths- Update to match NSA * Merged run_init open_init_pty bug fix from Manoj Srivastava (unblock SIGCHLD). Bug reported by Erich Schubert.- Update to match NSA * Merged error shadowing bug fix for restorecon from Dan Walsh. * Merged setfiles usage/man page update for -r option from Dan Walsh. * Merged fixfiles -C patch to ignore :s0 addition on update to a MCS/MLS policy from Dan Walsh.- Add chcat script for use with chcon.- Fix restorecon to exit with error code* Updated version for release.- Add prereq for mount command- Update to match NSA * Changed setfiles -c to translate the context to raw format prior to calling libsepol.- Use new version of libsemange and require it for install- Ignore s0 in file context- Update to match NSA * Merged patch for fixfiles -C from Dan Walsh.- Update to match NSA * Merged fixes for semodule_link and sestatus from Serge Hallyn (IBM). Bugs found by Coverity.- Fix fixfiles to call sort -u followed by sort -d.- Change fixfiles to ignore /home directory on updates- Update to match NSA * Merged patch to move module read/write code from libsemanage to libsepol from Jason Tang (Tresys).- Update to match NSA * Changed semodule* to link with libsemanage.- Update to match NSA * Merged restorecon patch from Ivan Gyurdiev.- Update to match NSA * Merged load_policy, newrole, and genhomedircon patches from Red Hat.- Update to match NSA * Merged loadable module support from Tresys Technology.- Update to match NSA * Updated version for release.- Fix Ivan's patch for user role changes- Add Ivan's patch for user role changes in genhomedircon- Fix warning message on reload of booleans- Update to match NSA * Merged fixfiles and newrole patch from Dan Walsh. * Merged audit2why man page from Dan Walsh.- Add call to pam_acct_mgmt in newrole.- Update to match NSA * Extended audit2why to incorporate booleans and local user settings when analyzing audit messages.- Update to match NSA * Updated audit2why for sepol_ prefixes on Flask types to avoid namespace collision with libselinux, and to include now.- Fix fixfiles to accept -f - Update to match NSA * Added audit2why utility.- Change -f flag in fixfiles to remove stuff from /tmp - Change -F flag to pass -F flag to restorecon/fixfiles. (IE Force relabel).- Update to match NSA * Fixed signed/unsigned pointer bug in load_policy. * Reverted context validation patch for genhomedircon.- Update to mx>XLhJK$KKKndialog.cpython-312.opt-1.pyccommondialog.cpython-312.opt-2.pyccommondialog.cpython-312.pycconstants.cpython-312.opt-1.pycconstants.cpython-312.opt-2.pycconstants.cpython-312.pycdialog.cpython-312.opt-1.pycdialog.cpython-312.opt-2.pycdialog.cpython-312.pycdnd.cpython-312.opt-1.pycdnd.cpython-312.opt-2.pycdnd.cpython-312.pycfiledialog.cpython-312.opt-1.pycfiledialog.cpython-312.opt-2.pycfiledialog.cpython-312.pycfont.cpython-312.opt-1.pycfont.cpython-312.opt-2.pycfont.cpython-312.pycmessagebox.cpython-312.opt-1.pycmessagebox.cpython-312.opt-2.pycmessagebox.cpython-312.pycscrolledtext.cpython-312.opt-1.pycscrolledtext.cpython-312.opt-2.pycscrolledtext.cpython-312.pycsimpledialog.cpython-312.opt-1.pycsimpledialog.cpython-312.opt-2.pycsimpledialog.cpython-312.pyctix.cpython-312.opt-1.pyctix.cpython-312.opt-2.pyctix.cpython-312.pycttk.cpython-312.opt-1.pycttk.cpython-312.opt-2.pycttk.cpython-312.pyccolorchooser.pycommondialog.pyconstants.pydialog.pydnd.pyfiledialog.pyfont.pymessagebox.pyscrolledtext.pysimpledialog.pytix.pyttk.pyturtle.pyturtledemo__init__.py__main__.py__pycache____init__.cpython-312.opt-1.pyc__init__.cpython-312.opt-2.pyc__init__.cpython-312.pyc__main__.cpython-312.opt-1.pyc__main__.cpython-312.opt-2.pyc__main__.cpython-312.pycbytedesign.cpython-312.opt-1.pycbytedesign.cpython-312.opt-2.pycbytedesign.cpython-312.pycchaos.cpython-312.opt-1.pycchaos.cpython-312.opt-2.pycchaos.cpython-312.pycclock.cpython-312.opt-1.pycclock.cpython-312.opt-2.pycclock.cpython-312.pyccolormixer.cpython-312.opt-1.pyccolormixer.cpython-312.opt-2.pyccolormixer.cpython-312.pycforest.cpython-312.opt-1.pycforest.cpython-312.opt-2.pycforest.cpython-312.pycfractalcurves.cpython-312.opt-1.pycfractalcurves.cpython-312.opt-2.pycfractalcurves.cpython-312.pyclindenmayer.cpython-312.opt-1.pyclindenmayer.cpython-312.opt-2.pyclindenmayer.cpython-312.pycminimal_hanoi.cpython-312.opt-1.pycminimal_hanoi.cpython-312.opt-2.pycminimal_hanoi.cpython-312.pycnim.cpython-312.opt-1.pycnim.cpython-312.opt-2.pycnim.cpython-312.pycpaint.cpython-312.opt-1.pycpaint.cpython-312.opt-2.pycpaint.cpython-312.pycpeace.cpython-312.opt-1.pycpeace.cpython-312.opt-2.pycpeace.cpython-312.pycpenrose.cpython-312.opt-1.pycpenrose.cpython-312.opt-2.pycpenrose.cpython-312.pycplanet_and_moon.cpython-312.opt-1.pycplanet_and_moon.cpython-312.opt-2.pycplanet_and_moon.cpython-312.pycrosette.cpython-312.opt-1.pycrosette.cpython-312.opt-2.pycrosette.cpython-312.pycround_dance.cpython-312.opt-1.pycround_dance.cpython-312.opt-2.pycround_dance.cpython-312.pycsorting_animate.cpython-312.opt-1.pycsorting_animate.cpython-312.opt-2.pycsorting_animate.cpython-312.pyctree.cpython-312.opt-1.pyctree.cpython-312.opt-2.pyctree.cpython-312.pyctwo_canvases.cpython-312.opt-1.pyctwo_canvases.cpython-312.opt-2.pyctwo_canvases.cpython-312.pycyinyang.cpython-312.opt-1.pycyinyang.cpython-312.opt-2.pycyinyang.cpython-312.pycbytedesign.pychaos.pyclock.pycolormixer.pyforest.pyfractalcurves.pylindenmayer.pyminimal_hanoi.pynim.pypaint.pypeace.pypenrose.pyplanet_and_moon.pyrosette.pyround_dance.pysorting_animate.pytree.pyturtle.cfgtwo_canvases.pyyinyang.py/usr/lib//usr/lib/.build-id//usr/lib/.build-id/8d//usr/lib64/python3.12/__pycache__//usr/lib64/python3.12/lib-dynload//usr/lib64/python3.12//usr/lib64/python3.12/tkinter//usr/lib64/python3.12/tkinter/__pycache__//usr/lib64/python3.12//usr/lib64/python3.12//usr/lib64/python3.12/turtledemo//usr/lib64/python3.12/turtledemo/__pycache__/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnux.XLLL G $R 7.4.26-1Dan Muey - 7.4.25-2Cory McIntire - 7.4.25-1Julian Brown - 7.4.24-23Cory McIntire - 7.4.24-2Cory McIntire - 7.4.24-1Travis Holloway - 7.4.23-1Cory McIntire - 7.4.22-1Cory McIntire - 7.4.21-1Travis Holloway - 7.4.20-2Cory McIntire - 7.4.20-1Cory McIntire - 7.4.19-1Cory McIntire - 7.4.18-1Cory McIntire - 7.4.16-2Cory McIntire - 7.4.16-1Cory McIntire - 7.4.15-1Cory McIntire - 7.4.14-1Julian Brown - 7.4.13-2Cory McIntire - 7.4.13-1Tim Mullin - 7.4.12-2Cory McIntire - 7.4.12-1Daniel Muey - 7.4.11-4Tim Mullin - 7.4.11-3Daniel Muey - 7.4.11-2Cory McIntire - 7.4.11-1Tim Mullin - 7.4.10-2Cory McIntire - 7.4.10-1Cory McIntire - 7.4.9-1Tim Mullin - 7.4.8-2Cory McIntire - 7.4.8-1Julian Brown - 7.4.7-2Cory McIntire - 7.4.7-1Tim Mullin - 7.4.6-3Tim Mullin - 7.4.6-2Cory McIntire - 7.4.6-1Daniel Muey - 7.4.5-3Tim Mullin - 7.4.5-2Cory McIntire - 7.4.5-1Julian Brown - 7.4.2-3Daniel Muey - 7.4.2-2Daniel Muey - 7.4.2-1Dan Muey - 7.4.1-1- EA4-173: Mark ea-php74 as EOL- EA4-230: Use system libxml2 in PHP 7.4- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12614: Rolling “ea-php74” back to “2ae8a0c01d69dbc710734ff516c17a19a479fa13”: was not meant to be merged- ZC-12614: Build on Alma 9- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- ZC-12246: Correct conffiles for Ubuntu- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: work around `%doc` and `PHP` behavior changes from C7 to c9- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link with libc-client statically- ZC-10873: Do not build on Ubuntu 22- EA-11075: Correct default value description for log_errors in php.ini- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11038: Update ea-php74 from v7.4.32 to v7.4.33- EA-10957: Update ea-php74 from v7.4.30 to v7.4.32- EA-10757: Update ea-php74 from v7.4.29 to v7.4.30- EA-10632: Update ea-php74 from v7.4.28 to v7.4.29- EA-10532: Update litespeed to 8.0.1- EA-10504: Update ea-php74 from v7.4.27 to v7.4.28- EA-10461: Patch PHP-FPM/OpCache for kill_all_lockers bug (74709)- ZC-9611: Dependency issue with php-enchant.- ZC-9598: Fix Ubuntu 21 global regs problem- ZC-7454: Add php-sodium- EA-10364: Update ea-php74 from v7.4.26 to v7.4.27- EA-10279: Update ea-php74 from v7.4.25 to v7.4.26- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10228: Update ea-php74 from v7.4.24 to v7.4.25- ZC-9368: Correct build issues from changes to ea-tools- EA-10137: disable upstream regression tests in favor of our own- EA-10136: Update ea-php74 from v7.4.23 to v7.4.24- EA-10081: Update ea-php74 from v7.4.22 to v7.4.23- EA-10009: Update ea-php74 from v7.4.21 to v7.4.22- EA-9925: Update ea-php74 from v7.4.20 to v7.4.21- EA-9013: Optimize %check section- EA-9831: Update ea-php74 from v7.4.19 to v7.4.20- EA-9752: Update ea-php74 from v7.4.18 to v7.4.19- EA-9737: Update ea-php74 from v7.4.16 to v7.4.18- EA-9625: Update litespeed to 7.9- EA-9622: Update ea-php74 from v7.4.15 to v7.4.16- EA-9565: Update ea-php74 fx(lXL9$ 999od - 1.14.4-3Robbie Harwood - 1.14.4-2Robbie Harwood - 1.14.4-1Robbie Harwood - 1.14.3-9Robbie Harwood - 1.14.3-8Robbie Harwood - 1.14.3-7Robbie Harwood - 1.14.3-6Robbie Harwood - 1.14.3-5Robbie Harwood - 1.14.3-4Robbie Harwood - 1.14.3-3Robbie Harwood - 1.14.3-2Robbie Harwood - 1.14.3-1Robbie Harwood - 1.14.1-9Robbie Harwood - 1.14.1-8Robbie Harwood - 1.14.1-7Robbie Harwood - 1.14.1-6Robbie Harwood - 1.14.1-5Robbie Harwood - 1.14.1-4Robbie Harwood - 1.14.1-3Robbie Harwood - 1.14.1-2Robbie Harwood - 1.14.1-1Robbie Harwood - 1.14-23Robbie Harwood - 1.14-22Robbie Harwood - 1.14-21Fedora Release Engineering - 1.14-20Robbie Harwood - 1.14-19Robbie Harwood - 1.14-18Robbie Harwood - 1.14-17Robbie Harwood - 1.14-16Robbie Harwood - 1.14-15Robbie Harwood - 1.14-14Robbie Harwood - 1.14-13Robbie Harwood - 1.14-12Robbie Harwood - 1.14-11Robbie Harwood - 1.14-10Robbie Harwood - 1.14-9Robbie Harwood - 1.14-beta2-8Robbie Harwood - 1.14-beta1-7Robbie Harwood - 1.14-beta1-6Robbie Harwood - 1.14-beta1-5Robbie Harwood - 1.14-beta1-4Robbie Harwood - 1.14-beta1-3Robbie Harwood - 1.14-beta1-2Robbie Harwood - 1.14-beta1-1Robbie Harwood - 1.13.2-13Robbie Harwood - 1.13.2-12Robbie Harwood - 1.13.2-11Robbie Harwood - 1.13.2-10Robbie Harwood - 1.13.2-9Robbie Harwood - 1.13.2-8Robbie Harwood - 1.13.2-7Roland Mainz - 1.13.2-6Roland Mainz - 1.13.2-5Roland Mainz - 1.13.2-4Fedora Release Engineering - 1.13.2-3Roland Mainz - 1.13.2-2Roland Mainz - 1.13.2-1Roland Mainz - 1.13.2-0Roland Mainz - 1.13.1-4Roland Mainz - 1.13.1-3Roland Mainz - 1.13.1-2Roland Mainz - 1.13.1-1Roland Mainz - 1.13-8Roland Mainz - 1.13-7Nathaniel McCallum - 1.13-6Roland Mainz - 1.13-5Roland Mainz - 1.13-4Roland Mainz - 1.13-3Roland Mainz - 1.13-2Roland Mainz - 1.13-1Roland Mainz - 1.13-0.alpha1.3Roland Mainz - 1.13-0.alpha1.3Nalin Dahyabhai - 1.13-0.alpha1.3Nalin Dahyabhai - 1.13-0.alpha1.2Nalin Dahyabhai - 1.13-0.alpha1.1Nalin Dahyabhai - 1.12.2-3Fedora Release Engineering - 1.12.2-2Nalin Dahyabhai - 1.12.2-1Nalin Dahyabhai - 1.12.1-14Nalin Dahyabhai - 1.12.1-13Nalin Dahyabhai - 1.12.1-12Tom Callaway - 1.12.1-11Nalin Dahyabhai - 1.12.1-10Nalin Dahyabhai - 1.12.1-9Nalin Dahyabhai * Add support for Xen ocontexts from Paul Nuzzi.- Update to upstream * Fixed bug preventing semanage node -a from working from Chad Sellers * Fixed bug preventing semanage fcontext -l from working from Chad Sellers - Change semanage to use unicode- Update to upstream * Remove setrans management from semanage, as it does not work from Dan Walsh. * Move load_policy from /usr/sbin to /sbin from Dan Walsh.- Raise exception if user tries to add file context with an embedded space- Fix sandbox to setsid so it can run under mozilla without crashing the session- Update to upstream * Factor out restoring logic from setfiles.c into restore.c- Fix typo in seobject.py- Allow semanage -i and semanage -o to generate customization files. - semanage -o will generate a customization file that semanage -i can read and set a machines to the same selinux configuration- Fix restorecond man page- Add generation of the users context file to polgengui- Remove tabs from system-config-selinux glade file- Remove translations screen from system-config-selinux- Move fixfiles man pages into the correct package - Add genhomedircon to fixfiles restore- Add check to sandbox to verify save changes - Chris Pardy - Fix memory leak in restorecond - Steve Grubb- Fixes Templates- Fixes for polgengui to handle tcp ports correctly - Fix semanage node -a- Fixes for semanage -equiv, readded modules, --enable, --disable- Close sandbox when eclipse exits- Security fixes for seunshare - Fix Sandbox to handle non file input to command.- Security fixes for seunshare- Update to upstream * Change semodule upgrade behavior to install even if the module is not present from Dan Walsh. * Make setfiles label if selinux is disabled and a seclabel aware kernel is running from Caleb Case. * Clarify forkpty() error message in run_init from Manoj Srivastava.- Fix sandbox to handle relative paths- Add symbolic link to load_policy- Fix restorecond script to use force-reload- Fix init script to show status in usage message- Update to upstream * Add semanage dontaudit to turn off dontaudits from Dan Walsh. * Fix semanage to set correxhXPLh# $(r.- Cleanup man pages syntax - Add sepolgen- Update to upstream * Merged small fix to correct include of errcodes.h in semodule_deps from Dan Walsh.- Update to upstream * Merged new audit2allow from Karl MacMillan. This audit2allow depends on the new sepolgen python module. Note that you must run the sepolgen-ifgen tool to generate the data needed by audit2allow to generate refpolicy. * Fixed newrole non-pam build. - Fix Changelog and spelling error in man page- Fix audit2allow on missing translations- More chcat fixes- Change chcat to exec semodule so file context is maintained- Fix system-config-selinux ports view - Update to upstream * Fixed newrole non-pam build. * Updated version for stable branch.- Update to upstream * Merged unicode-to-string fix for seobject audit from Dan Walsh. * Merged man page updates to make "apropos selinux" work from Dan Walsh.* Merged newrole man page patch from Michael Thompson. * Merged patch to fix python unicode problem from Dan Walsh.- Fix handling of audit messages for useradd change Resolves: #222159- Update man pages by adding SELinux to header to fix apropos database Resolves: #217881- Want to update to match api - Update to upstream * Merged newrole securetty check from Dan Walsh. * Merged semodule patch to generalize list support from Karl MacMillan. Resolves: #200110- Update to upstream * Merged fixfiles and seobject fixes from Dan Walsh. * Merged semodule support for list of modules after -i from Karl MacMillan.- Update to upstream * Merged patch to correctly handle a failure during semanage handle creation from Karl MacMillan. * Merged patch to fix seobject role modification from Dan Walsh.- Stop newrole -l from working on non secure ttys Resolves: #200110- Update to upstream * Merged patches from Dan Walsh to: - omit the optional name from audit2allow - use the installed python version in the Makefiles - re-open the tty with O_RDWR in newrole- Update to upstream * Patch from Dan Walsh to correctly suppress warnings in load_policy.- Fix fixfiles script to use tty command correctly. If this command fails, it should set the LOGFILE to /dev/null Resolves: #220879- Remove hard coding of python2.4 from Makefiles- add exists switch to semanage to tell it not to check for existance of Linux user Resolves: #219421- Fix audit2allow generating reference policy - Fix semanage to manage user roles properly Resolves: #220071- Update po files - Fix newrole to open stdout and stderr rdrw so more will work on MLS machines Resolves: #216920- rebuild for python 2.5- Update po files Resolves: #216920- Update po files Resolves: #216920- Update to upstream * Patch from Dan Walsh to add an pam_acct_msg call to run_init * Patch from Dan Walsh to fix error code returns in newrole * Patch from Dan Walsh to remove verbose flag from semanage man page * Patch from Dan Walsh to make audit2allow use refpolicy Makefile in /usr/share/selinux/- Fixing the Makefile line again to build with LSPP support Resolves: #208838- Don't report errors on restorecond when file system does not support XATTRS Resolves: #217694- Fix -q qualifier on load_policy Resolves: #214827- Merge to upstream - Fix makefile line Resolves: #208838- Additional po changes - Added all booleans definitions- Upstream accepted my patches * Merged setsebool patch from Karl MacMillan. This fixes a bug reported by Yuichi Nakamura with always setting booleans persistently on an unmanaged system.- Fixes for the gui- Upstream accepted my patches- Add Amy Grifis Patch to preserve newrole exit status- Fix display of gui- Add patch by Jose Plans to make run_init use pam_acct_mgmt- More fixes to gui- Fix audit2allow to generate referene policy- Add group sort for portsPage.py - Add enable/disableaudit to modulex XL$8now resize window - Add support for compressed policy.xml - Miroslav Grepl patch to allow sepolicy interface on individual interface fil - Also add capability to test interfaces for correctness.- Apply patches from Sven Vermeulen for sepolgen to fix typos.- Only require selinux-policy-devel for policycoreutils-devel, this will shrink the size of the livecd.- Run sepolgen-ifgen in audit2allow and sepolicy generate, if needed, first time - Add Sven Vermeulen patches to cleanup man pages- No longer run sepolgen-ifgen at install time. - Run sepolgen-ifgen in audit2allow and sepolicy generate, if needed. - Update Translations- Fix exceptionion hanling in audit2allow -o - Generate Man pages for everydomain, not just ones with exec_t entrypoints - sepolicy comunicate should return ValueError not TypeError - Trim header line in sepolicy manpage to use less space - Add missing options to restorecon man page- Raise proper Exception on sepolicy communicate with invalid value- Update translations - Add patch by Miroslav Grepl to add compile test for sepolicy interface command.- Update translations - Add patch inspired by Miroslav Grepl to add extended information for sepolicy interface command.- Update translations - Add missing man pages and fixup existing man pages- Move sepolicy to policycoreutils-devel pacage, since most of it is used for devel - Apply Miroslav Grepl Patches for sepolicy -- Fix generate mutually groups option handling -- EUSER is used for existing policy -- customize options can be used together with admin_domain option -- Fix manpage.py to generate correct man pages for SELinux users -- Fix policy *.te file generated by customize+writepaths options -- Fix install script for confined_admin option- Add post install scripts for gui to make sure Icon Cache is refreshed. - Fix grammar issue in secon man page - Update Translations- Add buildrequires for OpenBox to prevent me from accidently building into RHEL7 - Add support for returning alias data to sepolicy.info python bindings- Fix audit2allow output to better align analysys with the allow rules - Apply Miroslav Grepl patch to clean up sepolicy generate usage - Apply Miroslav Grepl patch to fixupt handing of admin_user generation - Update Tranlslations- Allow semanage fcontext -a -t "<>" ... to work- Can not unshare IPC in sandbox, since it blows up Xephyr - Remove bogus error message sandbox about reseting setfsuid- Fix sepolicy generate --customize to generate policy with -w commands- sepolgen-ifgen needs to handle filename transition rules containing ":"- sepolicy manpage: - use nroff instead of man2html - Remove checking for name of person who created the man page - audit2allow - Fix output to show the level that is different.- Fix newrole to not drop capabilities from the bounding set. - Stop dropping capabilities from its children. - Add better error messages. - Change location of bash_completion files to /usr/share/bash-completion/compl- sepolicy generate should look for booleans that effect equivalence names, and add them to the man page- Mention creation of permissive domains in sepolicy generate man page - Change sepolicy manpage to use shortname with an "_" to stop accidently grabbing unrelated types for a domain. - Fix audit2allow to show better information on constraint violations.- Have restorecon exit -1 on errors for consistancy.- Need to provide a value to semanage boolean -m- Fix cut and paste errors for sepolicy network command- Fix sepoicy interface to work properly- Fix fixfiles to use exclude_dirs on fixfiles restore- Allow users with symlinked homedirs to work. call realpath on homedir - Fix sepolicy reorganization of helper functions.- Update trans - Fix sepolicy reorganization of helper functions.- remove vendor tag from desktop file. https://fedorahosted.org/fpc/ticket/247 - clean up spec to follow current guidelines- Do not load interface file by default when sepolicy is called, mov get_all_methods to the sepolicy package- sepolgen-ifgen should use the current policxȥXLyJ$iyJ@? H? d  , I|     n px0 X E (o8x9:G0H8I@XDYT\]^b$dteyf|l~tuv T X ^       4 8 <g @h DCcpanel-perl-542-sub-name0.281.cp130~el8CPAN module - (Re)name a subCpanel build perl module 'Sub::Name'(Re)name a subh~}bh-centos-8.dev.cpanel.netDperlcpanel/perlhttps://metacpan.orglinuxx86_643؁$$g_Bh~}22be97cf99c020ecc6fb3599646dd2f0f8c01763db9e0c7f40c0059b58c1de346f7b4b2c97b0dfc91b44892af85095ee819b077346106f39a15c374bc2c56912rootrootrootrootcpanel-perl-542-sub-name-0.28-1.cp130~el8.src.rpmcpanel-perl(Sub::Name)cpanel-perl-542-sub-namecpanel-perl-542-sub-name(x86-64)cpanel-perl-sub-name     cpanel-perl-542cpanel-perl-542-exportercpanel-perl-542-strictcpanel-perl-542-warningscpanel-perl-542-xsloaderrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h@b@`-@_@X@W@V<@Q+R@Todd Rinaldo - 0.28-1.cp130Busy Camels - 0.26-1.cp108Busy Camels - 0.26-1.cp1198Todd Rinaldo - 0.26-1.cp1194Todd Rinaldo - 0.21-1.cp1162Todd Rinaldo - 0.19-1.cp1162Todd Rinaldo - 0.14-1.cp1156Todd Rinaldo - 0.05-1.cp1136- Update from upstream: Sub-Name 0.28- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Sub-Name 0.26- Update from upstream: Sub-Name 0.21- Update from upstream: Sub-Name 0.19- Update from upstream: Sub-Name 0.14- Update from upstream: Sub-Name 0.050.280.28-1.cp130~el80.28-1.cp130~el80.28Name.pmName.so/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/x86_64-linux/Sub//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/x86_64-linux/auto/Sub/Name/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuPerl5 module source textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=197a0655513b724f86c5ea62b53d1f16b0c54797, not strippedutf-82b7ac21b6ae0c81e7367adfdcb7632b9a0c3361a5ab872825d9b6ff0143403b4?# - 3.0801-1.cp130Busy Camels - 3.0800-1.cp108Busy Camels - 3.0800-1.cp1198Todd Rinaldo - 3.0800-1.cp1194Todd Rinaldo - 3.0702-1.cp1186Todd Rinaldo - 3.0701-1.cp1178Joshua Brandt - 3.0612-1.cp1156- Update from upstream: Statistics-Descriptive 3.0801- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Statistics-Descriptive 3.0800- Update from upstream: Statistics-Descriptive 3.0702- Update from upstream: Statistics-Descriptive 3.0701- Update from upstream: Statistics-Descriptive 3.0612xHXTL $B@慚ժ5yF2z&zp䪷E_zcYrIx(pWyw'5՛f!SFv:JTz-S] }QF"~KX_B):t3W~ǷǑn.~dG|m^< Qm ϼx~"Fi`H꿶,z^.UC%̒^ .^:tRV𢆃*FmXqI]?͜B5҄'ߊYB mae^Nx\2^Z%*I-ř6?b\?`X~֐w~T|]'2 #hn*St?9x&$`@ yCgU"5base (Prarit Bhargava) [1810244] - [kernel] posix-cpu-timers: Fixup stale comment (Prarit Bhargava) [1810244] - [include] alarmtimers: Avoid rtc.h include (Prarit Bhargava) [1810244] - [include] posix-timers: Cleanup forward declarations and includes (Prarit Bhargava) [1810244] - [kernel] hrtimer: Improve comments on handling priority inversion against softirq kthread (Prarit Bhargava) [1810244] - [kernel] posix-timers: Use a callback for cancel synchronization on PREEMPT_RT (Prarit Bhargava) [1810244] - [kernel] posix-timers: Move rcu_head out of it union (Prarit Bhargava) [1810244] - [kernel] posix-timers: Rework cancel retry loops (Prarit Bhargava) [1810244] - [kernel] posix-timers: Cleanup the flag/flags confusion (Prarit Bhargava) [1810244] - [kernel] itimers: Prepare for PREEMPT_RT (Prarit Bhargava) [1810244] - [fs] timerfd: Prepare for PREEMPT_RT (Prarit Bhargava) [1810244] - [kernel] alarmtimer: Prepare for PREEMPT_RT (Prarit Bhargava) [1810244] - [kernel] sched/deadline: Ensure inactive_timer runs in hardirq context (Prarit Bhargava) [1810244] - [kernel] timers: Prepare support for PREEMPT_RT (Prarit Bhargava) [1810244] - [kernel] hrtimer: Prepare support for PREEMPT_RT (Prarit Bhargava) [1810244] - [kernel] hrtimer: Determine hard/soft expiry mode for hrtimer sleepers on RT (Prarit Bhargava) [1810244] - [kernel] hrtimer: Move unmarked hrtimers to soft interrupt expiry on RT (Prarit Bhargava) [1810244] - [kernel] tick: Mark tick related hrtimers to expiry in hard interrupt context (Prarit Bhargava) [1810244] - [kvm] KVM: LAPIC: Mark hrtimer to expire in hard interrupt context (Prarit Bhargava) [1810244] - [kernel] watchdog: Mark watchdog_hrtimer to expire in hard interrupt context (Prarit Bhargava) [1810244] - [kernel] perf/core: Mark hrtimers to expire in hard interrupt context (Prarit Bhargava) [1810244] - [kernel] hrtimer: Make enqueue mode check work on RT (Prarit Bhargava) [1810244] - [kernel] sched: Mark hrtimers to expire in hard interrupt context (Prarit Bhargava) [1810244] - [staging] hrtimer/treewide: Use hrtimer_sleeper_start_expires() (Prarit Bhargava) [1810244] - [kernel] hrtimer: Provide hrtimer_sleeper_start_expires() (Prarit Bhargava) [1810244] - [kernel] hrtimer: Consolidate hrtimer_init() + hrtimer_init_sleeper() calls (Prarit Bhargava) [1810244] - [kernel] hrtimer: Remove task argument from hrtimer_init_sleeper() (Prarit Bhargava) [1810244] - [kernel] futex: Consolidate duplicated timer setup code (Prarit Bhargava) [1810244] - [kernel] posix-cpu-timers: Remove private interval storage (Prarit Bhargava) [1810xXUL0$ls. (Radek Holy) - Wrap some recently added long lines. (Radek Holy) - remove: BaseCli.reinstallPkgs (Radek Holy) - repos: repos can never expire. (RhBug:1069538) (Ales Kozumplik) - build: rebuild with 9d95442 (updated summaries_cache). (Ales Kozumplik) - doc: update summaries_cache. (Ales Kozumplik)- fix: ensure MDPayload always has a valid progress attribute. (RhBug:1069996) (Ales Kozumplik) - refactor: Move repo-pkgs upgrade-to to a standalone class instead of reusing the UpgradeToCommand. (Radek Holy) - remove: BaseCli.updatePkgs (Radek Holy) - refactor: Remove the reference to updatePkgs from UpgradeSubCommand. (Radek Holy) - refactor: Remove the reference to updatePkgs from UpgradeCommand. (Radek Holy) - refactor: Move repo-pkgs upgrade to a standalone class instead of reusing the UpgradeCommand. (Radek Holy) - remove: BaseCli.installPkgs (Radek Holy) - refactor: Remove the reference to installPkgs from InstallSubCommand. (Radek Holy) - refactor: Remove the reference to installPkgs from InstallCommand. (Radek Holy) - refactor: Move repo-pkgs install to a standalone class instead of reusing the InstallCommand. (Radek Holy) - Revert "Support filtering by repository name in install_groupie." (Radek Holy) - Revert "Support filtering by repository name in Base.select_group." (Radek Holy) - Drop group filtering by repository name from installPkgs. (Radek Holy) - Drop "repo-pkgs install @Group" support. (Radek Holy) - refactor: Move CheckUpdateCommand.check_updates to BaseCli. (Radek Holy) - refactor: Move repo-pkgs check-update to a standalone class instead of reusing the CheckUpdateCommand. (Radek Holy) - refactor: Move repo-pkgs list to a standalone class instead of reusing the ListCommand. (Radek Holy) - tests: Add tests of repo-pkgs info against the documentation. (Radek Holy) - Fix "repo-pkgs info installed" behavior with respect to the documentation. (Radek Holy) - refactor: Move MockBase methods to BaseStubMixin. (Radek Holy) - refactor: Move repo-pkgs info to a standalone class instead of reusing the InfoCommand. (Radek Holy) - refactor: Move InfoCommand._print_packages to BaseCli.output_packages. (Radek Holy)/bin/sh/bin/sh/bin/sh  !"#$%&'()*+,-./0123456789:;<=>?@arbgbncacsdadeeleneoeseufafifilfrfurgdguhehihrhuiditjakakkkoltmlmrmsnbnlorpaplptptrusksqsrsr@latinsvthtrukurvizhzh4.7.0-21.el8_10.alma.1  !"#$%&'()*+,-./0123456789:;<<=dnfdnf-makecache.servicednf-makecache.timerbash-completioncompletionsdnfdnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf.modnf-transaction-json.5.gzdnf.modularity.7.gzdnf.8.gzyum2dnf.8.gzdnf/usr/bin//usr/lib/systemd/system//usr/share//usr/share/bash-completion//usr/share/bash-completion/completions//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/x(XVLP$b;=3bb75abf684959792e3b76134cfc4ef9f879cb35e02c63c582f26371ea624eb58b2f711d2b30c343506d0c1867eabd6d1c676c82301d343a04fce21456bdad46b657b9430186d7f588180c13f61dfd5bb932cc5a0c3bb9caa8ed74889a19a8d3ee3cb6707ea8f63595ec350b04ecaac02e68f11ec1a406a6ce8a4b17e4f8af74f76157e0776360d0dd041f2762d940018b38fdc0eab74b8266e2259487ed7ab47585bea8460a6a4573d83d89e88cf69b2286e8af7b414ae54d542138a0335b837a696da3319a491194664a05dde66698dc4f083792df6aaed1e5d94e879852d72f1f24ac09c8fb4cd144c6c883300593114fb9286af9360cc9d871a40e5dcbea4aedc24b832607d1dd71c7b965bcd1b9a216cec18aa250eeae01f9bc07785ead0ec8383e2b812fd7dfdd94825../../../../usr/lib64/python3.12/lib-dynload/_tkinter.cpython-312-x86_64-linux-gnu.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython3.12-3.12.14-1.el8_10.src.rpmpython3.12-tkinterpython3.12-tkinter(x86-64)python3.12-turtle@@@@@@     @libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpthread.so.0()(64bit)libtcl8.6.so()(64bit)libtk8.6.so()(64bit)python3.12rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.12.14-xxXW$ LHhD$xhDgDiD-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.moxkeyboard-config.7.gz/usr/share/X11//usr/share/X11/xkb//usr/share/X11/xkb/compat//usr/share/X11/xkb/geometry//usr/share/X11/xkb/geometry/digital_vndr//usr/share/X11/xkb/geometry/sgi_vndr//usr/share/X11/xkb/keycodes//usr/share/X11/xkb/keycodes/digital_vndr//usr/share/X11/xkb/keycodes/sgi_vndr//usr/share/X11/xkb/rules//usr/share/X11/xkb/symbols//usr/share/X11/xkb/symbols/digital_vndr//usr/share/X11/xkb/symbols/fujitsu_vndr//usr/share/X11/xkb/symbols/hp_vndr//usr/share/X11/xkb/symbols/jolla_vndr//usr/share/X11/xkb/symbols/macintosh_vndr//usr/share/X11/xkb/symbols/nec_vndr//usr/share/X11/xkb/symbols/nokia_vndr//usr/share/X11/xkb/symbols/sgi_vndr//usr/share/X11/xkb/symbols/sharp_vndr//usr/share/X11/xkb/symbols/sony_vndr//usr/share/X11/xkb/symbols/sun_vndr//usr/share/X11/xkb/symbols/xfree68_vndr//usr/share/X11/xkb/types//usr/share/doc//usr/share/doc/xkeyboard-config//usr/share/locale/af/LC_MESSAGES//usr/share/locale/az/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/crh/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/fur/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ky/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/rw/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man7/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m32 -march=x86-64 -mtune=generic -mfpmath=sse -mstackrealign -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnux2gX* L0`n"$~n"k|j{U 4d! - ^     0 4 8H\p,(89:&GHI(X,Yt\]^ b ud e f l  0 D H  X   g h Ccpanel-perl-536-data-dump1.251.cp108~el7CPAN module - Pretty printing of data structuresCpanel build perl module 'Data::Dump'Pretty printing of data structuresbbh-centos-7.dev.cpanel.netperlcpanel/perlhttps://metacpan.orglinuxnoarchH%$$$$`֦`ֈp`ֈp`ֈ967e7e9584ce2352f9331d5579070e44af1724c7806848c56adbcb76ce667f08312bd79d137a045747030d093f57bbfe3aaf8c6a975d9ef982578569e422ba356705a8eaa7b8988be3f5451028702776b9c2d038377061c3d7ddce0383333014a8f02529737d7a9c8c3ddb20bb76b24a868f45403f8bae64361ea3d295080006rootrootrootrootrootrootrootrootcpanel-perl-536-data-dump-1.25-1.cp108~el7.src.rpmcpanel-perl(Data::Dump)cpanel-perl(Data::Dump::FilterContext)cpanel-perl(Data::Dump::Filtered)cpanel-perl(Data::Dump::Trace)cpanel-perl(Data::Dump::Trace::Call)cpanel-perl(Data::Dump::Trace::Wrapper)cpanel-perl-536-data-dump-filtercontextcpanel-perl-536-data-dump-filteredcpanel-perl-536-data-dump-tracecpanel-perl-536-data-dump-trace-callcpanel-perl-536-data-dump-trace-wrappercpanel-perl-data-dumpcpanel-perl-data-dump-filtercontextcpanel-perl-data-dump-filteredcpanel-perl-data-dump-tracecpanel-perl-data-dump-trace-callcpanel-perl-data-dump-trace-wrappercpanel-perl-536-data-dump     cpanel-perl-536cpanel-perl-536-symbolrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b@b@`-@V<@S>Q+R@Todd Rinaldo - 1.25-1.cp108Busy Camels - 1.23-1.cp108Busy Camels - 1.23-1.cp1198Todd Rinaldo - 1.23-1.cp1156Todd Rinaldo - 1.22-1.cp1146Todd Rinaldo - 1.21-1.cp1136- Update from upstream: Data-Dump 1.25- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Data-Dump 1.23- Update from upstream: Data-Dump 1.22- Update from upstream: Data-Dump 1.211.25000.020.020.02000.020.020.021.25000.020.020.021.25-1.cp108~el7Dump.pmFilterContext.pmFiltered.pmTrace.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Data//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Data/Dump/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?<%a<񜉲(^48e0c0e24db270a97509e720d9038af2f2babab2cOcBip6t_rt.so1  libip6t_mh.so16libip6t_ipv6header.so1libip6t_icmp6.soc1 libip6t_hl.so16libip6t_hbh.sol1olibip6t_frag.so1slibip6t_eui64.so1.libip6t_dst.so1. libip6t_ah.so1clibip6t_SNPT.so1llibip6t_SNAT.so1llibip6t_REJECT.so1libip6t_REDIRECT.so 1llibip6t_NETMAP.soxWXY@Lx $  -php74 from v7.4.14 to v7.4.15- EA-9517: Update ea-php74 from v7.4.13 to v7.4.14- ZC-8005: Replace ea-openssl11 with system openssl on C8- EA-9448: Update ea-php74 from v7.4.12 to v7.4.13- EA-9424: Fix the build on CentOS 8- EA-9401: Update ea-php74 from v7.4.11 to v7.4.12- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- ZC-7497: Reinstate `runselftest`- EA-9339: Update ea-php74 from v7.4.10 to v7.4.11- EA-9281: Update litespeed from upstream to 7.8- EA-9282: Update ea-php74 from v7.4.9 to v7.4.10- EA-9224: Update ea-php74 from v7.4.8 to v7.4.9- EA-9189: Update litespeed from upstream to 7.7- EA-9150: Update ea-php74 from v7.4.7 to v7.4.8- ZC-6967: Build on C8- EA-9109: Update ea-php74 from v7.4.6 to v7.4.7- EA-9087: Fix PHP version in DSO description- EA-9072: Revert new .user.ini search behavior- EA-9070: Update ea-php74 from v7.4.5 to v7.4.6- ZC-6649: Re-enable multibyte regex for 7.4- EA-9014: Build ea-php74 with jpeg support- EA-9007: Update ea-php74 from v7.4.2 to v7.4.5- ZC-6287: Add php_intl with ea-libicu for C6- ZC-6287: Add libzip to zip Requires for C6- EA-8867: Update ea-php74 from v7.4.1 to v7.4.2- ZC-4640: Initial packaginghou-1 17889112977.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel20-pspell.inipspell.so.build-ide9a74f34744c02e597b4f81d358c14b93c0071/opt/cpanel/ea-php74/root/etc/php.d//opt/cpanel/ea-php74/root/usr/lib64/php/modules//usr/lib//usr/lib/.build-id/b6/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectionobs://private/EA4-production/CentOS_8/466948582fa1dfb821c86fa7fa52fc38-ea-php74cpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b6e9a74f34744c02e597b4f81d358c14b93c0071, strippeddirectoryݏ=`Uutf-815cda5cc4d03aa0d5aca16702133e3b736c3d4b3f0a7050b473e2222e7a769f7?PGj#x~|yd%?:jiCk<].hzW.'tenE5L3*F>~ uϹ,дaAi(#h 6W4b͂yyi垎P}b-?LF~TIQݟU6"u yڦHM)Hyvѷb4ov(ΐ!J@]pL޸Otn5b)pu 1&mq%r$1`p["sK7fe^:m/}.L 1Mِᵄ<"zod @fR HpuХ8T~ UfB8]uinrYujRIW5ẅ T0aԵ,]X{jj"1o4bm̃r)J4H6 +lɤ8*FZʩp]UE_i9^yBX|"oczwD|g+VauR.>Žpщj#x~|%Ȅ넻\C2'DSE1N~ M~sb(aX)sv~2fn\"_6qPj´1RtZvluVO?H'ȳ^)O|՛ 54]"Gۧ.=`2:ǧ4y mj6N[rޛ6WH/`=-D27 }NӞ|nq<TIZ?qq_N781a99015a87f741e721061f0c3a48addcc55e9ac711ae64a8cd1bf3a414491c809fcbd111ec3fcab92eb2814a5e783f18aeb1dcj8fj8n6982] - [netdrv] net: phy: add callback for custom interrupt handler to struct phy_driver (Petr Oros) [1816982] - [netdrv] net: phy: enable interrupts when PHY is attached already (Petr Oros) [1816982] - [netdrv] net: phy: sfp: enable i2c-bus detection on ACPI based systems (Petr Oros) [1816982] - [netdrv] net: phy: tja11xx: Switch to HWMON_CHANNEL_INFO() (Petr Oros) [1816982] - [netdrv] net: phylink: Add phylink_{printk, err, warn, info, dbg} macros (Petr Oros) [1816982] - [netdrv] net: phylink: Add PHYLINK_xFX+MLHȞT$)TTT fix typo in menu - configuration: - new services: tinc, vdsm, mosh, iscsi-target, rsyncd - ship and install XML Schema files. (#8) - man pages: - firewalld.dbus, firewalld.direct, firewalld, firewall-cmd - spec file: - filesystem subpackage - make dirs&files in /usr/lib/ world-readable (RHBZ#915988)- firewalld: - new runtimeToPermanent and tracked passsthrough support - make permanent D-Bus interfaces more fine grained like the runtime versions (RHBZ#1127706) - richLanguage: allow using destination with forward-port - Rich_Rule.check(): action can't be used with icmp-block/forward-port/masquerade - fixed Python specific D-Bus exception (RHBZ#1132441) - firewall-cmd: - new --runtime-to-permanent to create permanent from runtime configuration - use new D-Bus methods for permanent changes - show target REJECT instead of %REJECT% (RHBZ#1058794) - --direct: make fail messages consistent (RHBZ#1141835) - firewall-config: - richRuleDialog - OK button tooltip indicates problem - use new D-Bus methods for permanent changes - show target REJECT instead of %REJECT% (RHBZ#1058794) - update "Change Zones of Connections" menu on default zone change (RHBZ#11120212) - fixed rename of zones, services and icmptypes to not create new entry (RBHZ#1131064) - configuration: - new service for Squid HTTP proxy server - new service for Kerberos admin server - new services for syslog and syslog-tls - new services for SNMP and SNMP traps - add Keywords to .desktop to improve software searchability - docs: - updated translations - firewalld.richlanguage: improvements suggested by Rufe Glick - firewalld.dbus: various improvements - firewalld.zone: better description of Limit tag - mention new homepage everywhere- Quiet systemctl if cups-browsed.service is not installed- add few Requires to spec (RHBZ#1133167)- firewalld: - improve error messages - check built-in chains in direct chain handling functions (RHBZ#1120619) - dbus_to_python() check whether input is of expected type (RHBZ#1122018) - handle negative timeout values (RHBZ#1124476) - warn when Command/Uid/Use/Context already in lockdown whitelist (RHBZ#1126405) - make --lockdown-{on,off} work again (RHBZ#1111573) - firewall-cmd: - --timeout now accepts time units (RHBZ#994044) - firewall-config: - show active (not default) zones in bold (RHBZ#993655) - configuration: - remove ipp-client service from all zones (RHBZ#1105639). - fallbacks for missing values in firewalld.conf - create missing dirs under /etc if needed - add -Es to python command in lockdown-whitelist.xml (RHBZ#1099065) - docs: - 'direct' methods concern only chains/rules added via 'direct' (RHBZ#1120619) - --remove-[interface/source] don't need a zone to be specified (RHBZ#1125851) - various fixes in firewalld.zone(5), firewalld.dbus(5), firewalld.direct(5) - others: - rpm macros for easier packaging of e.g. services- Fixed wrong default zone names for server and workstation (RHBZ#1120296)- renamed fedora specific zones to FedoraServer and FedoraWorkstation for zone name limitations (length and allowed chars)- New support for Fedora per-product configuration settings for Fedora.next https://fedoraproject.org/wiki/Per-Product_Configuration_Packaging_Draft - Added Fedora server zone (RHBZ#1110711) - Added Fedora workstation zone(RHBZ#1113775)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- new services: freeipa-*, puppermaster, amanda-k5, synergy, xmpp-*, tor, privoxy, sane - do not use at_console in D-Bus policies (RHBZ#1094745) - apply all rich rules for non-default targets - AppData file (RHBZ#1094754) - separate Polkit actions for desktop & server (RHBZ#1091068) - sanitize missing ip6t_rpfilter (RHBZ#1074427) - firewall/core/io/*: few improvements (RHBZ#1065738) - no load failed error for absent direct.xml file - new DBUS_INTERFACE.getZoneSettings to get all run-time zone settings - fixed creation and deletion of zones, services and icmptypes over D-Bus signals - x6X[RL(>$>>>devel.1.git9460cd3Igor Gnatenko - 10.4-0.devel.8.gitf3b709c10.4-0.devel.7.git1a17098Igor Gnatenko - 10.4-0.devel.6.git1a17098Igor Gnatenko - 10.4-0.devel.5.gitc3f17bbIgor Gnatenko - 10.4-0.devel.4.git1f184bcIgor Gnatenko - 10.4-0.devel.3.git1f184bcIgor Gnatenko - 10.4-0.devel.2.1.80771e47b6c1e47ab55f17311e1d4e227a9eb3d8Igor Gnatenko - 10.4-0.devel.2.80771e47b6c1e47ab55f17311e1d4e227a9eb3d8Igor Gnatenko - 10.4-0.devel.1.c2867f5b3626157379ef0d4d5bcaf5180ca0ec1fIgor Gnatenko - 10.3-0.rc1.1.e7f2f2dea5acdbd1a12ed88914e64a38a97432f0Fedora Release Engineering - 10.3-0.devel.2.c40d7d6d948912a4d51cbf8f0854cf2ebe916636.1Igor Gnatenko - 10.3-0.devel.2.c40d7d6d948912a4d51cbf8f0854cf2ebe916636Igor Gnatenko - 10.3-0.devel.1.f381c27c548aa28b003c8e188f5d627ab4105f76Igor Gnatenko - 10.2.3-1.20140711Peter Robinson 10.2.2-4.20140625Igor Gnatenko - 10.2.2-3.20140625Dave Airlie 10.2.2-2.20140625Igor Gnatenko - 10.2.2-1.20140625Igor Gnatenko - 10.2.1-2.20140608Igor Gnatenko - 10.2.1-1.20140608Fedora Release Engineering - 10.2-0.11.rc5.20140531Dan Horák - 10.2-0.10.rc5.20140531Igor Gnatenko - 10.2-0.9.rc5.20140531Brent Baude - 10.2-0.8.rc4.20140524Igor Gnatenko - 10.2-0.7.rc4.20140524Igor Gnatenko - 10.2-0.6.rc4.20140524Igor Gnatenko - 10.2-0.5.rc3.20140517Igor Gnatenko - 10.2-0.4.rc2.20140510Igor Gnatenko - 10.2-0.3.rc1.20140505Igor Gnatenko - 10.2-0.2.rc1.20140505Igor Gnatenko - 10.2-0.1.rc1.20140505Igor Gnatenko - 10.2-0.rc1.20140505Igor Gnatenko - 10.1.1-3.20140430Igor Gnatenko - 10.1.1-2.20140419Igor Gnatenko - 10.1.1-1.20140419Adam Jackson 10.1-6.20140305Adam Jackson 10.1-5.20140305Adam Jackson 10.1-4.20140305Dave Airlie 10.1-3.20140305Dave Airlie 10.1-2.20140305Igor Gnatenko - 10.1-1.20140305Igor Gnatenko - 10.1-0.rc3.20140301Igor Gnatenko - 10.1-0.rc2.20140225Igor Gnatenko - 10.1-0.rc2.20140222Adel Gadllah - 10.1-0.rc1.20140208Igor Gnatenko - 10.0.3-1.20140206Kyle McMartin - 10.0.2-6.20140118Kyle McMartin - 10.0.2-5.20140118Kyle McMartin - 10.0.2-4.20140118Igor Gnatenko - 10.0.2-3.20140118- Enable v3d for Raspberry Pi graphic in AlmaLinux (Resolves: https://github.com/AlmaLinux/raspberry-pi/issues/32)- Fix two nouveau bugs for customer (RHEL-54452)- Fix off-by-one error for newblock allocation in dlist_alloc Resolves: https://issues.redhat.com/browse/RHEL-40566- Rebuild against LLVM 17- Update to 23.1.4- Update to 23.1.0- disable glthread for radeonsi (breaks totem)- Update to 22.3.0 final + fix mit-shm regression- Disable glthread for gnome-shell- Update to 22.3.0-rc4 + fix wayland dep version- Update to 22.3.0-rc3 + fix glthread regression fix- Update to 22.3.0-rc2- Update to 22.1.5 - add some crocus and llvmpipe fixes- Update to 22.1.1 - switch toxHg%X{L$ 85-25Dan Walsh 2.0.85-24Dan Walsh 2.0.85-23Dan Walsh 2.0.85-22Dan Walsh 2.0.85-21Dan Walsh 2.0.85-20Dan Walsh 2.0.85-19Dan Walsh 2.0.85-18Dan Walsh 2.0.85-17Dan Walsh 2.0.85-16Dan Walsh 2.0.85-15Dan Walsh 2.0.85-13Fedora Release Engineering - 2.0.85-12Dan Walsh 2.0.85-11Dan Walsh 2.0.85-10Dan Walsh 2.0.85-9Dan Walsh 2.0.85-8Dan Walsh 2.0.85-7Dan Walsh 2.0.85-6Dan Walsh 2.0.85-4Dan Walsh 2.0.85-3Dan Walsh 2.0.85-2Dan Walsh 2.0.85-1Dan Walsh 2.0.84-5Dan Walsh 2.0.84-4Dan Walsh 2.0.84-3Dan Walsh 2.0.84-2Dan Walsh 2.0.84-1Dan Walsh 2.0.83-37Dan Walsh 2.0.83-36Dan Walsh 2.0.83-35Dan Walsh 2.0.83-34Dan Walsh 2.0.83-33Dan Walsh 2.0.83-32jkeating - 2.0.83-31Dan Walsh 2.0.83-30Dan Walsh 2.0.83-29Dan Walsh 2.0.83-28Dan Walsh 2.0.83-27Dan Walsh 2.0.83-26Dan Walsh 2.0.83-25Dan Walsh 2.0.83-24Dan Walsh 2.0.83-23Dan Walsh 2.0.83-22Dan Walsh 2.0.83-21Dan Walsh 2.0.83-20Dan Walsh 2.0.83-19Dan Walsh 2.0.83-18Dan Walsh 2.0.83-17Dan Walsh 2.0.83-16Dan Walsh 2.0.83-15Dan Walsh 2.0.83-14Dan Walsh 2.0.83-13Dan Walsh 2.0.83-12Dan Walsh 2.0.83-11David Malcolm - 2.0.83-10Dan Walsh 2.0.83-9Dan Walsh 2.0.83-8Dan Walsh 2.0.83-7Dan Walsh 2.0.83-6David Malcolm - 2.0.83-5Dan Walsh 2.0.83-4Dan Walsh 2.0.83-3Dan Walsh 2.0.83-1Dan Walsh 2.0.82-31Dan Walsh 2.0.82-30Dan Walsh 2.0.82-29Dan Walsh 2.0.82-28Dan Walsh 2.0.82-27Dan Walsh 2.0.82-26Dan Walsh 2.0.82-25Dan Walsh 2.0.82-24Dan Walsh 2.0.82-23Dan Walsh 2.0.82-22Dan Walsh 2.0.82-21Dan Walsh 2.0.82-20Dan Walsh 2.0.82-18Dan Walsh 2.0.82-17Dan Walsh 2.0.82-15Dan Walsh 2.0.82-14Dan Walsh 2.0.82-13Dan Walsh 2.0.82-11Dan Walsh 2.0.82-10Dan Walsh 2.0.82-8Dan Walsh 2.0.82-7Dan Walsh 2.0.82-6Dan Walsh 2.0.82-5Dan Walsh 2.0.82-4Dan Walsh 2.0.82-3Dan Walsh 2.0.82-2Dan Walsh 2.0.82-1Dan Walsh 2.0.81-4Dan Walsh 2.0.81-3Dan Walsh 2.0.81-2Dan Walsh 2.0.81-1Dan Walsh 2.0.80-2Dan Walsh 2.0.80-1Dan Walsh 2.0.79-5Dan Walsh 2.0.79-4Dan Walsh 2.0.79-3Dan Walsh 2.0.79-2Dan Walsh 2.0.79-1Dan Walsh 2.0.x-@X;LPZ28$"283818 to v7.2.33- EA-9189: Update litespeed from upstream to 7.7- EA-9152: Update scl-php72 from v7.2.31 to v7.2.32- ZC-6875: Build on C8- EA-9087: Fix PHP version in DSO description- EA-9067: Update scl-php72 from v7.2.30 to v7.2.31- EA-9015: Update scl-php72 from v7.2.29 to v7.2.30- EA-8928: Updated the required version for ea-libcurl- EA-8931: Update scl-php72 from v7.2.28 to v7.2.29- ZC-6247: Remove conflict between php-fpm and runtime.- EA-8873: Update scl-php72 from v7.2.27 to v7.2.28- EA-8854: Fix circular dependencies in our PHP packages- EA-8850: Update scl-php72 from v7.2.26 to v7.2.27- ZC-4361: Update ea-openssl requirement to v1.1.1 (ZC-5583)- EA-8797: Update scl-php72 from v7.2.25 to v7.2.26- EA-8762: Update litespeed from upstream to 7.6- EA-8760: Update scl-php72 from v7.2.24 to v7.2.25- EA-8718: Update scl-php72 from v7.2.23 to v7.2.24- EA-8670: Update scl-php72 from v7.2.22 to v7.2.23- EA-8549: Build php-fpm with pcntl- EA-8635: Update scl-php72 from v7.2.21 to v7.2.22- EA-8593: Update scl-php72 from v7.2.20 to v7.2.21- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8560: Update scl-php72 from v7.2.19 to v7.2.20- EA-8538: Update litespeed from upstream to 7.4- EA-8514: Update scl-php72 from v7.2.18 to v7.2.19- ZC-5062: Add PLESK signal management to PHP-FPM- EA-8427: Update scl-php72 from v7.2.17 to v7.2.18- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Updated to version 7.2.17 via update_pkg.pl (EA-8320)- EA-8280: Update opache.ini blacklist file location to match PHP version- Updated to version 7.2.16 via update_pkg.pl (EA-8271)- Updated to version 7.2.15 via update_pkg.pl (EA-8209)- EA-7397: Compile with Argon2 support- EA-8170: Update litespeed to the latest version (7.2)- Updated to version 7.2.14 via update_pkg.pl (EA-8129)- Updated to version 7.2.13 via update_pkg.pl (EA-8044)- Updated to version 7.2.12 via update_pkg.pl (EA-7999)- EA-7957: Added ea-apache24-mod_proxy_fcgi as a dependency of php-fpm.- Updated to version 7.2.11 via update_pkg.pl (EA-7908)- Updated to version 7.2.10 via update_pkg.pl (EA-7837)- Updated to version 7.2.9 via update_pkg.pl (EA-7781)- Fixed php-fpm installing directories it does not own (EA-7526)- Updated to version 7.2.8 via update_pkg.pl (EA-7703)- Updated to version 7.2.7 via update_pkg.pl (EA-7595)- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- Updated to version 7.2.6 via update_pkg.pl (EA-7510)- Updated to version 7.2.5 via update_pkg.pl (EA-7430)- ZC-3605: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- EA-7343: Update to v7.2.4, drop v7.2.3- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- Updated to version 7.2.3 via update_pkg.pl (EA-7289)- Updated to version 7.2.2 via update_pkg.pl (EA-7208)- HB-3287: Increase open file limit for php-fpm by default- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- Updated to version 7.2.1 via update_pkg.pl (EA-7074)- EA-6764: Add back systzdata now that they have a 7.2 version- EA-6992: Update 7.2.0 dropping from RC status- EA-3099: Update 7.2.0 from RC5 to RC6- EA-6812: build PHP against ea-openssl like Apache- EA-6923: Update 7.2.0 from RC3 to RC5- EA-6866: Update mail-header patch for segfaults under Apache- EA-4653: Update mail header patch for PHP 7.2- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- EA-6857: Update 7.2.0 from RC1 to RC3- EA-6757: Update 7.2.0 from beta3 to RC1 - fix version specific symlinks - remove TZ patch for now (EA-6764 may re-add a version of it) - Add patch to fix RC1 bug https://bugs.php.net/bug.php?id=xX^zLPr$ - fix traceback from broken string formatting in _retrievePublicKey(). (RhBug:1111997) (Ales Kozumplik) - doc: replace Yum with DNF in command_ref.rst (Viktor Ashirov) - Fix a missing s in the title (mscherer) - api: add dnf.rpm.detect_releasever() (Ales Kozumplik) - Detect distroverpkg from 'system-release(release)' (RhBug:1047049) (Ales Kozumplik) - bulid: add dnf/conf to cmake. (Ales Kozumplik) - lint: clean up most lint messages in dnf.yum.config (Ales Kozumplik) - remove: couple of dead-code methods in dnf.yum.config. (Ales Kozumplik) - api: document client's responsibility to preset the substitutions. (RhBug:1104757) (Ales Kozumplik) - move: rpmUtils -> rpm. (Ales Kozumplik) - refactor: move yumvar out into its proper module dnf.conf.substitutions. (Ales Kozumplik) - refactor: turn dnf.conf into a package. (Ales Kozumplik) - doc: api_base.rst pointing to nonexistent method. (Ales Kozumplik) - remove: some logging from Transaction.populate_rpm_ts(). (Ales Kozumplik) - Update cli_vs_yum.rst (James Pearson) - api: doc: queries relation specifiers, with an example. (RhBug:1105009) (Ales Kozumplik) - doc: phrasing in ip_resolve documentation. (Ales Kozumplik) - cli: refactored transferring cmdline options to conf (Jan Silhan) - cli: added -4/-6 option for using ipv4/ipv6 connection (RhBug:1093420) (Jan Silhan) - cosmetic: empty set inicialization (Jan Silhan) - repo: improve the RepoError message to include URL. (Ales Kozumplik) - remove: dnf.yum.config.writeRawRepoFile(). (Ales Kozumplik) - remove: bunch of (now) blank config options. (Ales Kozumplik) - removed unique function (Jan Silhan) - tests: mock.assert_has_calls() enforces its iterable arguments in py3.4. (Ales Kozumplik) - logging: improve how repolist logs the total number of packages. (Ales Kozumplik) - logging: Base.close() should not log to the terminal. (Ales Kozumplik)- doc: packaging: add license block to each .rst. (Ales Kozumplik) - cosmetic: replaced yum with dnf in comment (Jan Silhan) - takes non-ascii cmd line input (RhBug:1092777) (Jan Silhan) - replaced 'unicode' conversion functions with 'ucd' (RhBug:1095861) (Jan Silhan) - using write_to_file py2/py3 compatibility write function (Jan Silhan) - encoding: all encode methods are using utf-8 coding instead of default ascii (Jan Silhan) - fixed rpmbuild warning of missing file (Jan Silhan) - transifex update (Jan Silhan) - fixed typos in comments (Jan Silhan) - Drop --debugrepodata and susetags generation with it. (Ales Kozumplik) - doc: document --debugsolver. (Ales Kozumplik) - fix: 'dnf repo-pkgs' failures (RhBug:1092006) (Radek Holy) - lint: make dnf_pylint take '-s' that suppresses line/column numbers. (Ales Kozumplik) - doc: cli_vs_yum: we do not promote installs to the obsoleting package. (RhBug:1096506) (Ales Kozumplik) - dealing with installonlies, we always need RPMPROB_FILTER_OLDPACKAGE (RhBug:1095580) (Ales Kozumplik) - transifex update (Jan Silhan) - arch: recognize noarch as noarch's basearch. (RhBug:1094594) (Ales Kozumplik) - pylint: clean up dnf.repo. (Ales Kozumplik) - sslverify: documentation and bumped librepo require. (Ales Kozumplik) - repos: support sslverify setting. (RhBug:1076045) (Ales Kozumplik) - search: exact matches should propagate higher. (RhBug:1093888) (Ales Kozumplik) - refactor: concentrate specific search functionality in commands.search. (Ales Kozumplik) - refactor: SearchCommand in its own file. (Ales Kozumplik) - pylint: fix around one hundred pylint issues in dnf.base. (Ales Kozumplik) - pylint: add simple pylint script (Ales Kozumplik) - autoerase: write out the debugdata used to calculate redundant packages. (Ales Kozumplik) - cosmetic: fix pylint comment in test_group.py. (Ales Kozumplik) - refactor: err_mini_usage() is public. (Ales Kozumplik) - refactor: fix several pylint errors in dnf.cli.commands.group. (Ales Kozumplik) - fix: 'dnf remove' is deprecated so autoremove should be autoerase. (Ales Kozumplik) - doc: command_ref: remove the deprecated aliases from the initial list. (Ales Kozumplik) - Add autoremove command. (RhxPX_) L$n"? ? \d!& 2 m   " $ ( i lpuz7(]8d 9 :) GHIXY\ 0] 4^ ?b vd e f l t u v     X l p      g h Ccpanel-perl-542-config-crontab1.451.cp130~el8CPAN module - Read/Write Vixie compatible crontab(5) filesCpanel build perl module 'Config::Crontab'Read/Write Vixie compatible crontab(5) fileshbh-centos-8.dev.cpanel.netjMperlcpanel/perlhttps://metacpan.orglinuxnoarchjM$X[0dc538276e8bfe9d6ac3a1b4d2d36ec2b641bbebe3c8c2242b04b388414d6eb3rootrootcpanel-perl-542-config-crontab-1.45-1.cp130~el8.src.rpmcpanel-perl(Config::Crontab)cpanel-perl(Config::Crontab::Base)cpanel-perl(Config::Crontab::Block)cpanel-perl(Config::Crontab::Comment)cpanel-perl(Config::Crontab::Container)cpanel-perl(Config::Crontab::Env)cpanel-perl(Config::Crontab::Event)cpanel-perl-542-config-crontabcpanel-perl-542-config-crontab-basecpanel-perl-542-config-crontab-blockcpanel-perl-542-config-crontab-commentcpanel-perl-542-config-crontab-containercpanel-perl-542-config-crontab-envcpanel-perl-542-config-crontab-eventcpanel-perl-config-crontabcpanel-perl-config-crontab-basecpanel-perl-config-crontab-blockcpanel-perl-config-crontab-commentcpanel-perl-config-crontab-containercpanel-perl-config-crontab-envcpanel-perl-config-crontab-event     cpanel-perl-542rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@YX@XtW@S>Q+R@Busy Camels - 1.45-1.cp130Busy Camels - 1.45-1.cp108Busy Camels - 1.45-1.cp1198Todd Rinaldo - 1.45-1.cp1170Todd Rinaldo - 1.43-1.cp1162J. Nick Koston - 1.41-1.cp1162Todd Rinaldo - 1.41-1.cp1162Todd Rinaldo - 1.40-1.cp1146Todd Rinaldo - 1.33-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Config-Crontab 1.45- Update from upstream: Config-Crontab 1.43- Update patches: Config-Crontab 1.41- Update from upstream: Config-Crontab 1.41- Update from upstream: Config-Crontab 1.40- Update from upstream: Config-Crontab 1.331.450000001.45-1.cp130~el80000001.45000000Crontab.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Config/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-86540a123bef99ed8f651b1028cc9672cff956db0b3188e57a29e0753f28bbffd?k8zPyBͿ72df3b709ea147faf3962d3b8cb143572f324878a6cc9a4dd76b90fbe9b2d846e323002abcea343a0c1d19ba0c47c11081b4b2ab0j{xX`Lp-$--K0ܽzsNo$IGCD|uTF j:ʤ76~$šeuj"wG 1BY>+t6̵b8*-'[KDWY&|1vsӫG<_;cm,p)A˧jD.Fӕqp맇F^(s 'p@cѥOQ{]Q LT?J Fg6*wrhOj ƶ`zٜUWC\AbADZLN8^&_ +x?@OgUzqvP;}xsXuz{Z2-viV0鱣'W } k,vN8@phCgԧu14k6tOicwCO)(Ε(佷ro]{207f664755e93285ededd46044213c69a9cfcd1caf04d26892121d1b63725943122496808bfde03f4e17d13f19d8fe49af30f81baj{yj{x7(5363aac03101d9514fe1d032e6e2948884f2513bde(58bd71239224d228b0d7e769008c94e5aaf43d79fc(6226b2e4a8d2c4db011859f42ca123eb334db2abe7(5b03078fdfa40e69e963d61fa1c0be438964e28d5d(57d4cb2f983d904f8298bbbe7040ed5ad109377281(5b09124377708e7330cc9bbf3469a32f250ab1df5"d(5e66027884ddb32960a5361eabe6f2411bfdcd561 d(5e1255b17144d0b3b47e2011966936bc3df9bd18f(5df0e2d192da0ff20c8f49bc19bfb740810af19d0c(5ff78964fdb7055fe249a5203f434c84762db784d8(57a985aba1dc368c5a2275a52473827165b375a97a(5212a46a8174dcc240d250b5c7549bff8a9d11460d(583721bfa411d27d282b50a5e5d5d8a18d37fe8949(5414ece27597b2557dcbd9827f858ca3a7e64290fb(585e1a12c93309cd6ff1b132c145a7f27005515111(56c1988dda502f737b265fcbf6706914131de49c79(527948a1f8a3ba72e6f445573d8b407c7e677c7f2b5(52ee241f7999d30189ca56b39c044ec95db579301Q4(58f4e20b0c4ec2942487f3a1a23f1fdd6f74dd7e3Ec(54e617fe4c2a6ade794b280ba575a0615ab59248fAb(540077003311ea043b49120776ab81bd8f7419a5498(524a5b9689aca85f9357ee8db4c69a0427746a0856c(59a4c0fb07a9a37a662811f70d965346b757bbe5028(586269e035aaa655bed2d21a6f7ba5779d6b8589b*a(583e8da9d2a7683b5e2465d01061d2bf8ee3e71d17(554b155940d66125a2e2ed55e6aa835b9d19be026(57edaa95b25f17713ddc5bbd534f771ed08e91b8%'5(5a83eaae1e6e9f0ac3b001ad8ddf552dd3ac2f2d4T4(5a79f641933c3b7c047ba202bf6fe610270c8b77c5a(5a4e2dca12fe6605cf52b4eac61da4e65b2c55aa998(59b4a3691c9407f3a05ad68cc5d463111732c92190(5939d01da5040fcf1962e82e0898021ee378c32508(5906eae3001c81a22cbb28c5d7bb388c86356f28c(58d3e91cdaae6c5ba177348cc508ea5d84ce3c377e(58bd71239224d228b0d7e769008c94e5aaf43d79f~1(585b9d52a721508c919748a0221bded882ed1c757b(5845b0f59abfd0ffe6739f60a9a893fc7e73f8e81d(583721bfa411d27d282b50a5e5d5d8a18d37fe894d(57d4cb2f983d904f8298bbbe7040ed5ad10937728a(57c445af43c9fca4c9bd37a81b67b805c95408339(57ad0b9708be5b6d02a15875fa0d57f5d0ee60c58(57a985aba1dc368c5a2275a52473827165b375a979(57a0bc98c112976b80f33587bf4cea9d5e792734c3(578e2f6efa668057b1dd15762149bcb523bc5d13484(575d283ae9112dbe3348c469badc25c045e90bd9frs(56e61bed87d2e4f0c409daf465482cfa64361180oD(567c59ae79c5de47855ec519c61da83dddfd617005(5600975e01d17ecd2a464401f1070b896075b8d44(55af2dafea5eb237cf9f7df65bd131d2d46b7753f3(557e69b5e6969d32758e07edac0cf2d70ac5d1ef0va(55443d4c8d06273232549569712927d5b8a6574e7)8(5503db8adfc860d54209f46fb526f9044f42c9d1b4(53c8868ec546f7da98197a93a3fcd94f036583586:(538fd6867d869bc03db676bf5f834ec9c7b8b4dbd(536951f6f58abea7f009f47eb766157c9e4cdc3b97(5363aac03101d9514fe1d032e6e2948884f2513bdfb(530e903e4e0631e56b2808c0d0bdacec6c7d60a0fb(52ba8d8d03887689c6d245914537466aee07ce6e9o5(528eb570ad1beb2af92b59c7312b5e967b575f581V8(52339f2619d613732a7fd6cb8ad686f0a79771c45a(5212a46a8174dcc240d250b5c7549bff8a9d11460x@XaL *$ * * *t- fix #1614364 - losetup: /dev/loop1: failed to set up loop device - fix #1614852 - mount man page says sync option has no effect for ext4 - fix #1614843 - Man page of logger is missing -S option- refresh lastlog patch - fix #1595882 - wipefs should erase also secondary LUKSv2 header* rebuild to verify build flags- upgrade to v2.32.1 http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32.1-ReleaseNotes- Build only the python3 bindings- sync spec file with Fedora - move /etc/adjtime config from initscripts to util-linux - fix #1560642 - uuidd.service does not start - remove unused build option --enable-libmount-force-mountinfo (it's default now) - disable assert code- fix #1560283 - column does not properly handle spaces at beginning of tab-separated table columns- upgrade to v2.32- add BuildRequires gcc- upgrade to v2.32-rc1 http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for switch to libxcrypt- Fix directory ownership in python subpackage- fix dmesg for multi-line records- upgrade to final v2.31 - move rfkill to sbin (for backward compatibility)- fix build error- upgrade to v2.31-rc2 - enable rfkill- temporary disable rfkill (fix #1494855)- upgrade to v2.31-rc1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.31/v2.31-ReleaseNotes- upgrade to v2.30.2 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.2-ReleaseNotes- make ln-s usage more robust- fix post install script- fix #1390191 - systemd read-only container produces errors- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- upgrade to v2.30.1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.1-ReleaseNotes- upgrade to v2.30- upgrade to v2.30-rc1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30-ReleaseNotes- upgrade to v2.29.2 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.2-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- upgrade to v2.29.1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.1-ReleaseNotes- Rebuild for Python 3.6- upgrade to v2.29- upgrade to v2.29-rc2- upgrade to v2.29-rc1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29-ReleaseNotes- upgrade to stable 2.28.2 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28.2-ReleaseNotes- upgrade to stable 2.28.1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28.1-ReleaseNotes- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- fix #1234317 - CD / DVD are rarely automounted- refresh login-lastlog-create.patch- upgrade to stable v2.28- fix libblkid- upgrade to v2.28-rc2- upgrade to v2.28-rc1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28-ReleaseNotes - add patch to fix broken swapon - add subpackage util-linux-user (utils with dependence on libuser)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- fix #1299255 - boot.iso (from 20160117 Rawhide compose) incorrectly detected as minix FS- fix #1259745 - Can't start installation in Rawhide or F23 recent development images- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- upgrade to v2.27.1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.27/v2.27.1-ReleaseNotes- upgrade to v2.27- upgrade to v2.27-rc2- improve version usage in source url- fix #1251320 - rfe: please change login to not add /bin:/sbin to $PATH - apply patches from Lokesh Mandvekar to make spec file more portable- upgrade to v2.27-rc1 http://ftp.kernel.org/pub/linux/utils/util-linux/v2.27/v2.27-ReleaseNotes - add lsipc- fix dates in the spec file- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- upgrade to stable release 2.26.2 ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.26/v2.26.2-ReleaseNotes- Rebuilt for Fedora 23 Change https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- upgrade to stable release 2xXbL4$44K?d ; ` 1]cl     ,Or   (89p: GTHpIXY\]^<bde f lt(uDv`wxy$04:|~  DmghCperl-LWP-MediaTypes6.0215.module_el8.5.0+2812+ed912d05Guess media type for a file or a URLThis module provides functions for handling media (also known as MIME) types and encodings. The mapping from file extensions to media types is defined by the media.types file. If the ~/.media.types file exists it is used instead. For backwards compatibility we will also look for ~/.mime.types.bb!ppc64le-builder01.almalinux.orgAlmaLinuxAlmaLinux(GPL+ or Artistic) and Public DomainAlmaLinux Packaging Team Development/Librarieshttp://search.cpan.org/dist/LWP-MediaTypes/linuxnoarch mN—A큤A큤bb!O=j O< Abb!bb!bb O=hcd12ceb13bc44e70c5bcf1a455ceb2405ffb51ff90e0eb868832d9a7f517125f0844071ccbc184e7376c61051986c0b7bc3f0e6094c052ceaafd3d057673c17dc47d4db90609bcca89629abf973ece190e906a7b3367a0a4567c7887caf29b237520b93c631b1c1051ff23a952de235f0be5566b3cba1e0783e75f2e06975994b469fded6cd6a83153b666d10e452036150f7e0f3fd15523577007cc2193d2bcrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-LWP-MediaTypes-6.02-15.module_el8.5.0+2812+ed912d05.src.rpmperl(LWP::MediaTypes)perl-LWP-MediaTypes@@    mailcapperl(:MODULE_COMPAT_5.26.3)perl(Exporter)perl(File::Basename)perl(strict)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-1perl-libwww-perl64.14.3\Z|;YyY3@XW8dV=@UUn@SvSQQQPP H@OOMAMMJitka Plesnikova - 6.02-15Fedora Release Engineering - 6.02-14Fedora Release Engineering - 6.02-13Jitka Plesnikova - 6.02-12Fedora Release Engineering - 6.02-11Jitka Plesnikova - 6.02-10Fedora Release Engineering - 6.02-9Fedora Release Engineering - 6.02-8Jitka Plesnikova - 6.02-7Jitka Plesnikova - 6.02-6Fedora Release Engineering - 6.02-5Fedora Release Engineering - 6.02-4Petr Pisar - 6.02-3Fedora Release Engineering - 6.02-2Petr Šabata - 6.02-1Fedora Release Engineering - 6.01-6Petr Pisar - 6.01-5Fedora Release Engineering - 6.01-4Marcela Mašláňová - 6.01-3Petr Pisar - 6.01-2Petr Pisar 6.01-1- Rebuild with enable hardening (bug #16363x XcQLbT$-TTTduring start when FirewallD is not running (RHBZ#966518) - firewall-applet: more fixes to make the address sources family agnostic - Better defaults for lockdown white list - Use auth_admin_keep for allow_any and allow_inactive also - New D-Bus API for lockdown policies - Use IPv4, IPv6 and BRIDGE for FirewallD properties - Use rich rule action as audit type - Prototype of string-only D-Bus interface for rich language - Fixed wrongly merged source family check in firewall/core/io/zone.py - handle_cmr: report errors, cleanup modules in error case only, mark handling - Use audit type from rule action, fixed rule output - Fixed lockdown whitelist D-Bus handling method names - New rich rule handling in runtime D-Bus interface - Added interface, source and rich rule handling (runtime and permanent) - Fixed dbus_obj in FirewallClientConfigPolicies, added queryLockdown - Write changes in setLockdownWhitelist - Fixed typo in policies log message in method calls - firewall-cmd: Added rich rule, lockdown and lockdown whitelist handling - Don't check access in query/getLockdownWhitelist*() - firewall-cmd: Also output masquerade flag in --list-all - firewall-cmd: argparse is able to convert argument to desired type itself - firewall-cmd_test.sh: tests for permanent interfaces/sources and lockdown whitelist - Makefile.am: add missing files - firewall-cmd_test.sh: tests for rich rules - Added lockdown, source, interface and rich rule docs to firewall-cmd - Do not masquerade lo if masquerade is enabled in the default zone (RHBZ#904098) - Use in metavar for firewall-cmd parser- removed unintentional en_US.po from tarball- Fix signal handling for SIGTERM - Additional service files (RHBZ#914859) - Updated po files - s/persistent/permanent/ (Trac Ticket #7) - Better behaviour when running without valid DISPLAY (RHBZ#955414) - client.handle_exceptions(): do not loop forever - Set Zone.defaults in zone_reader (RHBZ#951747) - client: do not pass the dbus exception name to handler - IO_Object_XMLGenerator: make it work with Python 2.7.4 (RHBZ#951741) - firewall-cmd: do not use deprecated BaseException.message - client.py: fix handle_exceptions() (RHBZ#951314) - firewall-config: check zone/service/icmptype name (RHBZ#947820) - Allow 3121/tcp (pacemaker_remote) in cluster-suite service. (RHBZ#885257) - firewall-applet: fix default zone hangling in 'shields-up' (RHBZ#947230) - FirewallError.get_code(): check for unknown error- Make permanenent changes work with Python 2.7.4 (RHBZ#951741)- Use explicit file lists for make dist - New rich rule validation check code - New global check_port and check_address functions - Allow source white and black listing with the rich rule - Fix error handling in case of unsupported family in rich rule - Enable ip_forwarding in masquerade and forward-port - New functions to read and write simple files using filename and content - Add --enable-sysconfig to install Fedora-specific sysconfig config file. - Add chains for security table (RHBZ#927015) - firewalld.spec: no need to specify --with-systemd-unitdir - firewalld.service: remove syslog.target and dbus.target - firewalld.service: replace hard-coded paths - Move bash-completion to new location. - Revert "Added configure for new build env" - Revert "Added Makefile.in files" - Revert "Added po/Makefile.in.in" - Revert "Added po/LINGUAS" - Revert "Added aclocal.m4" - Amend zone XML Schema- Added rich language support - Added lockdown feature - Allow to bind interfaces and sources to zones permanently - Enabled IPv6 NAT support masquerading and port/packet forwarding for IPv6 only with rich language - Handle polkit errors in client class and firewall-config - Added priority description for --direct --add-rule in firewall-cmd man page - Add XML Schemas for zones/services/icmptypes XMLs - Don't keep file descriptors open when forking - Introduce --nopid option for firewalld - New FORWARD_IN_ZONES and FORWARD_OUT_ZONES chains (RHBZ#912782) - Update cluster-suite service (RHBZ#885257) - firewall-cmd: rename --enable/disable-panic txXd{LPX$Bug:963345) (Ales Kozumplik) - refactor: Base.push_userinstalled() is public. (Ales Kozumplik) - Remove sudo from dnf-completion.bash RhBug:1073457 (Elad Alfassa) - exclude switch takes as a parameter (Jan Silhan) - using nevra glob query during list command (RhBug:1083679) (Jan Silhan) - removed rpm.RPMPROB_FILTER_REPLACEOLDFILES filter flag (Jan Silhan) - test: changed tests according to new distro-sync behavior (Jan Silhan) - packaging: cosmetic: copyright years in bin/dnf. (Ales Kozumplik) - bin/dnf: run the python interpreter with -OO. (Ales Kozumplik)- drpm: output stats (RhBug:1065882) (Ales Kozumplik) - refactor: architectures. (Ales Kozumplik) - cli: be lot less verbose about dep processing. (Ales Kozumplik) - groups: do not error out if group install/remove produces no RPM transaction. (Ales Kozumplik) - fix: do not traceback on comps remove operations if proper pkg reasons can not be found. (Ales Kozumplik) - fix: tracebacks in 'group remove ...' (Ales Kozumplik) - groups: move all the logic of persistor saving from main.py to Base. (Ales Kozumplik) - groups: auto-saving the groups persistor. (RhBug:1089864) (Ales Kozumplik) - transifex update (Jan Silhan) - remove: profiling code from cli.main. (Ales Kozumplik) - remove: removal of dead code (Miroslav Suchý) - doc: changes to rhbug.py to work on readthedocs.org. (Ales Kozumplik) - doc: build the documentation without any dependencies (on DNF or anything else). (Ales Kozumplik) - doc: make clear where one should expect bin/dnf (Miroslav Suchý) - abrt: disable abrt for 'dnf makecache timer' run from systemd.service. (RhBug:1081753) (Ales Kozumplik) - remove: stray itertools import from group.py. (Ales Kozumplik)- doc: fix formatting in api_cli.rst. (Ales Kozumplik) - doc: document operation of 'group upgrade'. (Ales Kozumplik) - comps: ensure only packages of 'group' reason get deleted on 'group erase'. (Ales Kozumplik) - comps: store 'group' reason when installing a group-membering package. (Ales Kozumplik) - Override Goal.get_reason(). (Ales Kozumplik) - Add dnf.goal.Goal deriving from hawkey.Goal. (Ales Kozumplik) - fix: encoding of yumdb directory names in py3. (Ales Kozumplik) - tests: clean up the functions that load seeded comps a bit. (Ales Kozumplik) - remove: cli._*aybeYouMeant(). (Ales Kozumplik) - simplify groups/envs API methods in Base a lot. (Ales Kozumplik) - tests: add test for Base._translate_comps_pkg_types() (Ales Kozumplik) - refactor: move the group listing etc. methods() away from Base into GroupCommand. (Ales Kozumplik) - api: add group.upgrade opration to Base and CLI (RhBug:1029022) (Ales Kozumplik) - remove: OriginalGroupPersistor. (Ales Kozumplik) - groups: store format version of the groups db. (Ales Kozumplik) - groups: saving the persistent data. (Ales Kozumplik) - refactor: extract out the transactioning part of _main(). (Ales Kozumplik) - groups: Integrate the redone components with Base. (Ales Kozumplik) - Add comps Solver. (Ales Kozumplik) - groups: redo the GroupPersistor class. (Ales Kozumplik) - doc: faq: why we don't check for root. (RhBug:1088166) (Ales Kozumplik) - cosmetic: reordered import statements (Jan Silhan) - added --refresh option (RhBug:1064226) (Jan Silhan) - added forgotten import (Jan Silhan) - fixed import errors after yum/i18n.py removal (Jan Silhan) - removed to_utf8 from yum/i18n.py (Jan Silhan) - removed to_str from yum/i18n.py (Jan Silhan) - removed utf8_text_fill from yum/i18n.py (Jan Silhan) - removed utf8_width from yum/i18n.py (Jan Silhan) - removed utf8_width_fill from yum/i18n.py (Jan Silhan) - removed to_unicode from yum/i18n.py (Jan Silhan) - make all strings unicode_literals implicitly (Jan Silhan) - moved _, P_ to dnf/i18n.py (Jan Silhan) - removed utf8_valid from yum/i18n.py (Jan Silhan) - removed str_eq from yum/i18n.py (Jan Silhan) - removed exception2msg from yum/i18n.py (Jan Silhan) - removed dummy_wrapper from yum/i18n.py (Jan Silhan) - cosmetics: leave around the good things from 660c3e5 (documentation, UT). (Ales Kozumplik) - Revert "fix: pxpXeL$e - 8.1.25-1Cory McIntire - 8.1.24-1Cory McIntire - 8.1.23-1Cory McIntire - 8.1.22-1Cory McIntire - 8.1.21-1Cory McIntire - 8.1.20-1Travis Holloway - 8.1.19-5Julian Brown - 8.1.19-4Julian Brown - 8.1.19-3Brian Mendoza - 8.1.19-2Cory McIntire - 8.1.19-1Julian Brown - 8.1.18-2Cory McIntire - 8.1.18-1Cory McIntire - 8.1.17-1Cory McIntire - 8.1.16-1Cory McIntire - 8.1.15-1Tim Mullin - 8.1.14-2Cory McIntire - 8.1.14-1Cory McIntire - 8.1.13-1Travis Holloway - 8.1.12-2Cory McIntire - 8.1.12-1Cory McIntire - 8.1.11-1Julian Brown - 8.1.10-3Dan Muey - 8.1.10-2Cory McIntire - 8.1.10-1Cory McIntire - 8.1.9-1Cory McIntire - 8.1.8-1Cory McIntire - 8.1.7-1Cory McIntire - 8.1.6-1Cory McIntire - 8.1.5-1Cory McIntire - 8.1.4-1Travis Holloway - 8.1.3-2Cory McIntire - 8.1.3-1Tim Mullin - 8.1.2-1Julian Brown - 8.1.1-4Dan Muey - 8.1.1-3Julian Brown - 8.1.1-2Cory McIntire - 8.1.1-1Julian Brown - 8.1.0-1Julian Brown - 8.1.0rc6-1Cory McIntire - 8.1.0beta3-1- EA4-173: Mark ea-php81 as EOL- EA4-230: Use system libxml2 in PHP 8.1- EA-13298: Update ea-php81 from v8.1.33 to v8.1.34 - Fixed GHSA-8xr5-qppj-gvwj (PDO quoting result null deref). (CVE-2025-14180) - Fixed GHSA-h96m-rvf9-jgm2 (Heap buffer overflow in array_merge()). (CVE-2025-14178) - Fixed GHSA-3237-qqm7-mfv7 (Information Leak of Memory in getimagesize). (CVE-2025-14177)- EA-13088: Update php-litespeed to 8.3- EA4-122: map u24 libodbc for PHP extension- EA-13001: Update ea-php81 from v8.1.32 to v8.1.33 - Fixed GHSA-hrwm-9436-5mv3 (pgsql extension does not check for errors during escaping). (CVE-2025-1735) - Fixed GHSA-453j-q27h-5p8x (NULL Pointer Dereference in PHP SOAP Extension via Large XML Namespace Prefix). (CVE-2025-6491) - Fixed GHSA-3cr5-j632-f35r (Null byte termination in hostnames). (CVE-2025-1220)- EA-12766: Update ea-php81 from v8.1.31 to v8.1.32 - Fixed GHSA-hgf54-96fm-v528 (Stream HTTP wrapper header check might omit basic auth header). (CVE-2025-1736) - Fixed GHSA-52jp-hrpf-2jff (Stream HTTP wrapper truncate redirect location to 1024 bytes). (CVE-2025-1861) - Fixed GHSA-pcmh-g36c-qc44 (Streams HTTP wrapper does not fail for headers without colon). (CVE-2025-1734) - Fixed GHSA-v8xr-gpvj-cx9g (Header parser of `http` stream wrapper does not handle folded headers). (CVE-2025-1217) - Fixed GHSA-p3x9-6h7p-cgfc (libxml streams use wrong `content-type` header when requesting a redirected resource). (CVE-2025-1219) - Fixed GHSA-rwp7-7vc6-8477 (Reference counting in php_request_shutdown causes Use-After-Free). (CVE-2024-11235)- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- EA-12576: Update ea-php81 from v8.1.30 to v8.1.31 - (Single byte overread with convert.quoted-printable-decode filter). (CVE-2024-11233) - (Configuring a proxy in a stream context might allow for CRLF injection in URIs). (CVE-2024-11234) - (Integer overflow in the dblib quoter causing OOB writes). (CVE-2024-11236) - (Integer overflow in the firebird quoter causing OOB writes). (CVE-2024-11236) - (Leak partial content of the heap through heap buffer over-read). (CVE-2024-8929) - (OOB access in ldap_escape). (CVE-2024-8932)- ZC-12246: Correct conffiles for Ubx|xXL$Pct context.- Add rpm support to fixfiles - Update restorecon to add file input support- Update with NSA Latest- rebuilt- Fix run_init to use policy formats- Update from NSA- Change location of file_context file- Change to use /etc/sysconfig/selinux to determine location of policy files- Update to latest from NSA - Change fixfiles to prompt before deleteing /tmp files- have restorecon ingnore <> - Hand matchpathcon the file status- Update to match NSA- Move location of log file to /var/tmp- Better grep command for bind- Eliminate bind and context mounts- update to match NSA- Log fixfiles to the /tmp directory- Add patch to fall back to authenticating via uid if the current user's SELinux user identity is the default identity - Add BuildRequires pam-devel- Add man page, thanks to Richard Halley- Upgrade to latest from NSA- Update with latest from gentoo and NSA- Check return codes in sestatus.c- Fix sestatus to not double free - Fix sestatus.conf to be unix format- Warn on setfiles failure to relabel.- Updated version of sestatus- Fix fixfiles to checklabel properly- add sestatus- Change free call to freecon - Cleanup- Remove setfiles-assoc patch - Fix restorecon to not crash on missing dir- Eliminate trailing / in restorecon- Add Verbosity check- Change restorecon to not follow symlinks. It is too difficult and confusing - to figure out the file context for the file pointed to by a symlink.- Fix restorecon- Read restorecon patch- Change genhomedircon to take POLICYSOURCEDIR from command line- Add checkselinux - move fixfiles and restorecon to /sbin- Restore patch of genhomedircon- Add setfiles-assoc patch to try to freeup memory use- Add fixlabels- Update to latest from NSA- Increase the size of buffer accepted by setfiles to BUFSIZ.- genhomedircon should complete even if it can't read /etc/default/useradd- fix restorecon to relabel unlabled files.- Add genhomedircon from tresys - Fixed patch for restorecon- exit out when selinux is not enabled- Fix minor bugs in restorecon- Add restorecon c program- Update to latest tarball from NSA- Add sort patch- rebuilt- remove mods to run_init since init scripts don't require it anymore- fix genhomedircon not to return and error- add setfiles quiet patch- add checkcon to verify context match file_context- fix command parsing restorecon- Add restorecon- Update to latest NSA 1.4- Change run_init.console to run as run_init_t- Remove dietcc since load_policy is not in mkinitrd - Change to use CONSOLEHELPER flag- Don't authenticate run_init when used with consolehelper- Add run_init consolehelper link- Add russell spead up patch to deal with file path stems- Build load_policy with diet gcc in order to save space on initrd- Update with NSA latest- remove i18n - Temp remove gtk support- Remove wnck requirement- Add gtk support to run_init- Add internationalization- Initial versionpolicycoreutils-python  !"#$%&'()*+,-2.9-26.el8_10 2.4-4org.selinux.confaudit2allowaudit2whychcatsandboxsemanagesemanageaudit2allow.1.gzaudit2why.1.gzchcat.8.gzsandbox.8.gzsemanage-boolean.8.gzsemanage-dontaudit.8.gzsemanage-export.8.gzsemanage-fcontext.8.gzsemanage-ibendport.8.gzsemanage-ibpkey.8.gzsemanage-import.8.gzsemanage-interface.8.gzsemanage-login.8.gzsemanage-module.8.gzsemanage-node.8.gzsemanage-permissive.8.gzsemanage-port.8.gzsemanage-user.8.gzsemanage.8.gzaudit2allow.1.gzaudit2why.1.gzchcat.8.x`pXgLm $3to python2-policycoreutils See https://fedoraproject.org/wiki/FinalizingFedoraSwitchtoPython3- Update to upstream release 2017-08-04 - Move DBUS API from -gui to -dbus package- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuild with binutils fix for ppc64le (#1475636)- Make 'sepolicy manpage' and 'sepolicy transition' faster - open_init_pty: restore stdin/stdout to blocking upon exit - fixfiles: do not dereference link files in tmp - fixfiles: use a consistent order for options to restorecon - fixfiles: don't ignore `-F` when run in `-C` mode - fixfiles: remove bad modes of "relabel" command - fixfiles: refactor into the `set -u` dialect - fixfiles: if restorecon aborts, we should too - fixfiles: usage errors are fatal - fixfiles: syntax error - fixfiles: remove two unused variables - fixfiles: tidy up usage(), manpage synopsis - fixfiles: deprecate -l option - fixfiles: move logit call outside of redirected function - fixfiles: fix logging about R/O filesystems - fixfiles: clarify exclude_dirs() - fixfiles: remove (broken) redundant code- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- semanage: Unify argument handling (#1398987) - setfiles: set up a logging callback for libselinux - setfiles: Fix setfiles progress indicator - setfiles: stdout messages don't need program prefix - setfiles: don't scramble stdout and stderr together (#1435894) - restorecond: Decrease loglevel of termination message (#1264505) - fixfiles should handle path arguments more robustly - fixfiles: handle unexpected spaces in command - fixfiles: remove useless use of cat (#1435894) - semanage: Add checks if a module name is passed in (#1420707) - semanage: fix export of fcontext socket entries (#1435127) - selinux-autorelabel: remove incorrect redirection to /dev/null (#1415674)- Fix selinux-polgengui (#1432337) - sepolicy - fix obtaining domain name in HTMLManPages- Fix several issues in gui and 'sepolicy manpage' (#1416372)- Use %{__python3} instead of python3- Fix pp crash when processing base module (#1417200) - Update to upstream release 2016-10-14- Rebuild for brp-python-bytecompile- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuild for python 3.6- seobject: Handle python error returns correctly - policycoreutils/sepolicy/gui: fix current selinux state radiobutton - policycoreutils: semodule_package: do not fail with an empty fc file- Update translations - Fix fcontextPage editing features (#1344842)- sandbox: Use dbus-run-session instead of dbus-launch when available - hll/pp: Change warning for module name not matching filename to match new behavior - Remove LDFLAGS from CFLAGS - sandbox: create a new session for sandboxed processes - sandbox: do not try to setup directories without -X or -M - sandbox: do not run xmodmap in a new X session - sandbox: Use GObject introspection binding instead of pygtk2 - sandbox: fix file labels on copied files - sandbox: tests - close stdout of p - sandbox: tests - use sandbox from cwd - audit2allow: tests should use local copy not system - audit2allow: fix audit2why import from seobject - audit2allow: remove audit2why so that it gets symlinked - semanage: fix man page and help message for import option - semanage: fix error message for fcontext -m - semanage: Fix semanage fcontext -D - semanage: Correct fcontext auditing - semanage: Default serange to "s0" for port modify - semanage: Use socket.getprotobyname for protocol - semanage: fix modify action in node and interface - fixfiles: Pass -n to restorecon for fixfiles check - sepolicy: Check get_rpm_nvr_list() return value - Don't use subprocess.getstatusoutput() in Python 2 code - semanage: Add auditing of changes in records - Remove unused 'q' from semodule getopt string- Remove unused autoconf files from po/ - Remove duplicate, empty translation files - Rebuilt with libsepol-2.5-9, libselinux-2.5-11, libsemanage-2.5-7- Fix sandbox -X issue related to python3 (#1358138)- Use generator approach to fix autorelabel- https://fedorapxh_XL r$6_domtrans description in sepolicy generate- Fix selinux-polgengui, get_all_modules call- Speed up startup time of sepolicy gui - Clean up ports screen to only show enabled ports. - Update to upstream * Remove import policycoreutils.default_encoding_utf8 from semanage from Dan Walsh. * Make yum/extract_rpms optional for sepolicy generate from Dan Walsh. * Add test suite for audit2allow and sepolgen-ifgen from Dan Walsh.- Shift around some of the files to more appropriate packages. * semodule_* packages are required for devel.- Update to upstream * Properly build the swig exception file from Laurent Bigonville. * Fix man pages from Laurent Bigonville. * Support overriding PATH and INITDIR in Makefile from Laurent Bigonville. * Fix LDFLAGS usage from Laurent Bigonville. * Fix init_policy warning from Laurent Bigonville. * Fix semanage logging from Laurent Bigonville. * Open newrole stdin as read/write from Sven Vermeulen. * Fix sepolicy transition from Sven Vermeulen. * Support overriding CFLAGS from Simon Ruderich. * Create correct man directory for run_init from Russell Coker. * restorecon GLOB_BRACE change from Michal Trunecka. * Extend audit2why to report additional constraint information. * Catch IOError errors within audit2allow from Dan Walsh. * semanage export/import fixes from Dan Walsh. * Improve setfiles progress reporting from Dan Walsh. * Document setfiles -o option in usage from Dan Walsh. * Change setfiles to always return -1 on failure from Dan Walsh. * Improve setsebool error r eporting from Dan Walsh. * Major overhaul of gui from Dan Walsh. * Fix sepolicy handling of non-MLS policy from Dan Walsh. * Support returning type aliases from Dan Walsh. * Add sepolicy tests from Dan Walsh. * Add org.selinux.config.policy from Dan Walsh. * Improve range and user input checking by semanage from Dan Walsh. * Prevent source or target arguments that end with / for substitutions from Dan Walsh. * Allow use of <> for semanage fcontext from Dan Walsh. * Report customized user levels from Dan Walsh. * Support deleteall for restoring disabled modules from Dan Walsh. * Improve semanage error reporting from Dan Walsh. * Only list disabled modules for module locallist from Dan Walsh. * Fix logging from Dan Walsh. * Define new constants for file type character codes from Dan Walsh. * Improve bash completions from Dan Walsh. * Convert semanage to argparse from Dan Walsh (originally by Dave Quigley). * Add semanage tests from Dan Walsh. * Split semanage man pages from Dan Walsh. * Move bash completion scripts from Dan Walsh. * Replace genhomedircon script with a link to semodule from Dan Walsh. * Fix fixfiles from Dan Walsh. * Add support for systemd service for restorecon from Dan Walsh. * Spelling corrections from Dan Walsh. * Improve sandbox support for home dir symlinks and file caps from Dan Walsh. * Switch sandbox to openbox window manager from Dan Walsh. * Coalesce audit2why and audit2allow from Dan Walsh. * Change audit2allow to append to output file from Dan Walsh. * Update translations from Dan Walsh. * Change audit2why to use selinux_current_policy_path from Dan Walsh.- Fix handling of man pages.- Cleanup errors found by pychecker - Apply patch from Michal Trunecka to allow restorecon to handle {} in globs- sepolicy gui - mgrepl fixes for users and login - Update Translations.- sepolicy gui - mgrepl added delete screens for users and login - Fix lots of bugs. - Update Translations.- Fixes for fixfiles * exclude_from_dirs should apply to all types of restorecon calls * fixfiles check now works * exit with the correct status - semanage no longer import selinux- FixxPOXiLJx9$Q999dmin) authenticating using the old protocol over IPv4 again (RT#6920)- incorporate a fix to teach the file labeling bits about when replay caches are expunged (#576093)- switch to the upstream patch for #707145- klist: don't trip over referral entries when invoked with -s (#707145, RT#6915)- fixup URL in a comment - when built with NSS, require 3.12.10 rather than 3.12.9- update to 1.9.1: - drop no-longer-needed patches for CVE-2010-4022, CVE-2011-0281, CVE-2011-0282, CVE-2011-0283, CVE-2011-0284, CVE-2011-0285- kadmind: add upstream patch to fix free() on an invalid pointer (#696343, MITKRB5-SA-2011-004, CVE-2011-0285)- don't discard the error code from an error message received in response to a change-password request (#658871, RT#6893)- override INSTALL_SETUID at build-time so that ksu is installed into the buildroot with the right permissions (part of #225974)- backport change from SVN to fix a computed-value-not-used warning in kpropd (#684065)- turn off NSS as the backend for libk5crypto for now to work around its DES string2key not working (#679012) - add revised upstream patch to fix double-free in KDC while returning typed-data with errors (MITKRB5-SA-2011-003, CVE-2011-0284, #674325)- throw in a not-applied-by-default patch to try to make pkinit debugging into a run-time boolean option named "pkinit_debug"- turn on NSS as the backend for libk5crypto, adding nss-devel as a build dependency when that switch is flipped- krb5kdc init script: prototype some changes to do a quick spot-check of the TGS and kadmind keys and warn if there aren't any non-weak keys on file for them (to flush out parts of #651466)- add upstream patches to fix standalone kpropd exiting if the per-client child process exits with an error (MITKRB5-SA-2011-001), a hang or crash in the KDC when using the LDAP kdb backend, and an uninitialized pointer use in the KDC (MITKRB5-SA-2011-002) (CVE-2010-4022, #664009, CVE-2011-0281, #668719, CVE-2011-0282, #668726, CVE-2011-0283, #676126)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fix a compile error in the SELinux labeling patch when -DDEBUG is used (Sumit Bose)- properly advertise that the kpropd init script now supports force-reload (Zbysek Mraz, #630587)- pkinit: when verifying signed data, use the CMS APIs for better interoperability (#636985, RT#6851)- update to 1.9 final- fix link flags and permissions on shared libraries (ausil)- update to 1.9 beta 3- update to 1.9 beta 2- drop not-needed-since-1.8 build dependency on rsh (ssorce)- start moving to 1.9 with beta 1 - drop patches for RT#5755, RT#6762, RT#6774, RT#6775 - drop no-longer-needed backport patch for #539423 - drop no-longer-needed patch for CVE-2010-1322 - if WITH_NSS is set, built with --with-crypto-impl=nss (requires NSS 3.12.9)- incorporate upstream patch to fix uninitialized pointer crash in the KDC's authorization data handling (CVE-2010-1322, #636335)- rebuild- pull down patches from trunk to implement k5login_authoritative and k5login_directory settings for krb5.conf (#539423)- Rebuilt for gcc bug 634757- fix reading of keyUsage extensions when attempting to select pkinit client certs (part of #629022, RT#6775) - fix selection of pkinit client certs when one or more don't include a subjectAltName extension (part of #629022, RT#6774)- build with -fstack-protector-all instead of the default -fstack-protector, so that we add checking to more functions (i.e., all of them) (#629950) - also link binaries with -Wl,-z,relro,-z,now (part of #629950)- fix a logic bug in computing key expiration times (RT#6762, #627022)- update to 1.8.3 - drop backports of fixes for gss context expiration and error table registration/deregistration mismatch - drop patch for upstream #6750- tell krb5kdc and kadmind to create pid files, since they can - add logrotate configuration files for krb5kdc and kadmind (#462658) - fix parsing of the pidfile option in the KDC (upstream #6750)- libgssapi: pull in pax>XjLpG;$ ;;; ppc* (#203001)- rebuild- Update to stunnel-4.15- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Use pthread threading to fix crash on x86_64 (#179236)- rebuilt- Rebuild with newer openssl- Update to stunnel-4.14 - Override changed default pid file location, keep it in %{_localstatedir}/run- Update to stunnel-4.13- Update to stunnel-4.12- Enable IPv6 (#169050, patch by Peter Bieringer) - Don't ship another copy of man pages in HTML- Update to stunnel-4.11 - Fix int/size_t mismatches in stack_info () - Update Certificate-Creation for /etc/pki- Fix inetd mode - Remove unnecessary Requires: and BuildRequires: - Clean up the spec file- update to 4.10- add buildprereqs on libtool, util-linux; change textutils/fileutils dep to coreutils (#133961)- update to 4.08 - build stunnel as a PIE binary- Convert man pages to UTF-8- rebuilt- move the sample configuration to %doc, it shouldn't be used as-is (#124373)- update to 4.05- rebuilt- rebuilt- Fix libtool- rebuilt- fix xinetd configuration samples- rebuild- rebuilt- update to 4.04- use pkgconfig for information about openssl, if available- update to 4.03- update to 4.02- don't create a dummy cert- update to 4.00 - remove textutils and fileutils as buildreqs, add automake/autoconf- automated rebuild- automated rebuild- rebuild in new environment- update to 3.22, correcting a format-string vulnerability- update to 3.21a- log using LOG_AUTHPRIV facility by default (#47289) - make permissions on stunnel binary 0755 - implicitly trust certificates in %{_datadir}/ssl/trusted (#24034)- update to 3.19 to avoid problems with stunnel being multithreaded, but tcp wrappers not being thrad-safe- update to 3.17- update to 3.16- update to 3.15 - enable tcp-wrappers support- remove explicit requirement on openssl (specific version isn't enough, we have to depend on shared library version anyway)- update to 3.14- depend on make (#33148)- rebuild in new environment- update to 3.13 to get pthread, OOB, 64-bit fixes - don't need sdf any more- pull in sdf to build the man page (#22892)- update to 3.11 - chuck the SIGHUP patch (went upstream) - chuck parts of the 64-bit clean patch (went upstream)- update to 3.10 - more 64-bit clean changes, hopefully the last bunch- change piddir from the default /var/stunnel to /var/run - clean out pid file on SIGHUP- update to 3.9 to get a security fix- change all unsigned longs to u_int32_t when dealing with network addresses- make stunnel.pem also be (missingok)- move to Applications/Internet group - clean up %post script - make stunnel.pem %ghost %config(noreplace) - provide a sample file for use with xinetd- FHS compliance fixes - modify defaults- update to 3.8 - do not create certificate if one already exists- update to 3.7 - add patch to find /usr/share/ssl - change some perms- Modify spec file to match Red Hat standards- Updated to 3.4a - Patched for OpenSSL 0.9.4 - Cleaned up files section- Updated to 3.3- Initial RPMification/bin/sh/bin/sh/bin/sh &234567:;<=>?enplplpl5.71-2.el8_105.71-2.el8_10 stunnelstunnel.build-idb6fb45613272271dd1f43a2976bafa4060c919cbc7778b876c3bd2e35bdc2eddbe032aab78fc5cf1stunnel.servicestunnel@.servicestunnellibstunnel.sostunnel.bashCertificate-CreationVNC_StunnelHOWTO.htmlfaq.stunnel-2.htmlpop3-redirect.xinetdsfinger.xinetdstunnel-pop3s-client.confstunnel-sfinger.confstunnel.conf-sampletworzenie_certyfikatow.htmlstunnelCOPYING.mdCOPYRIGHT.mdstunnel.8.gzstunnel.8.gz/etc//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/b6//usr/lib/.build-id/c7//usr/lib/systemd/system//usr/lib64//usr/lib64/stunnel//usr/share/bash-cox@.XkOL`tT$+TTTfor configuration (RHBZ#994729) - firewall-cmd: indicate non-zero exit code with red color - rich-rule: enable to have log without prefix & log_level & limit - log-level warn/err -> warning/error (RHBZ#1009436) - Use policy DROP while reloading, do not reset policy in restart twice - Add _direct chains to all table and chain combinations - documentation improvements - New firewalld.direct(5) man page docbook source - tests/firewall-cmd_test.sh: make rich language tests work - Rich_Rule._import_from_string(): improve error messages (RHBZ#994150) - direct.passthrough wasn't always matching out_signature (RHBZ#967800) - firewall-config: twist ICMP Type IP address family logic. - firewall-config: port-forwarding/masquerading dialog (RHBZ#993658) - firewall-offline-cmd: New --remove-service= option (BZ#969106) - firewall-config: Options->Lockdown was not changing permanent. - firewall-config: edit line on doubleclick (RHBZ#993572) - firewall-config: System Default Zone -> Default Zone (RHBZ#993811) - New direct D-Bus interface, persistent direct rule handling, enabled passthough - src/firewall-cmd: Fixed help output to use more visual parameters - src/firewall-cmd: New usage output, no redirection to man page anymore - src/firewall/core/rich.py: Fixed forwad port destinations - src/firewall-offline-cmd: Early enable/disable handling now with mask/unmask - doc/xml/firewalld.zone.xml: Added more information about masquerade use - Prefix to log message is optional (RHBZ#998079) - firewall-cmd: fix --permanent --change-interface (RHBZ#997974) - Sort zones/interfaces/service/icmptypes on output. - wbem-https service (RHBZ#996668) - applet&config: add support for KDE NetworkManager connection editor - firewall/core/fw_config.py: New method update_lockdown_whitelist - Added missing file watcher for lockdown whitelist in config D-Bus interface - firewall/core/watcher: New add_watch_file for lockdown-whitelist and direct - Make use of IPv6 NAT conditional, based on kernel number (RHBZ#967376)- several rich rule check enhancements and fixes - firewall-cmd: direct options - check ipv4|ipv6|eb (RHBZ#970505) - firewall-cmd(1): improve description of direct options (RHBZ#970509) - several firewall-applet enhancements and fixes - New README - several doc and man page fixes - Service definitions for PCP daemons (RHBZ#972262) - bash-completion: add lockdown and rich language options - firewall-cmd: add --permanent --list-all[-zones] - firewall-cmd: new -q/--quiet option - firewall-cmd: warn when default zone not active (RHBZ#971843) - firewall-cmd: check priority in --add-rule (RHBZ#914955) - add dhcpv6 (for server) service (RHBZ#917866) - firewall-cmd: add --permanent --get-zone-of-interface/source --change-interface/source - firewall-cmd: print result (yes/no) of all --query-* commands - move permanent-getZoneOf{Interface|Source} from firewall-cmd to server - Check Interfaces/sources when updating permanent zone settings. - FirewallDConfig: getZoneOfInterface/Source can actually return more zones - Fixed toaddr check in forward port to only allow single address, no range - firewall-cmd: various output improvements - fw_zone: use check_single_address from firewall.functions - getZoneOfInterface/Source does not need to throw exception - firewall.functions: Use socket.inet_pton in checkIP, fixed checkIP*nMask - firewall.core.io.service: Properly check port/proto and destination address - Install applet desktop file into /etc/xdg/autostart - Fixed option problem with rich rule destinations (RHBZ#979804) - Better exception creation in dbus_handle_exceptions() decorator (RHBZ#979790) - Updated firewall-offline-cmd - Use priority in add, remove, query and list of direct rules (RHBZ#979509) - New documentation (man pages are created from docbook sources) - firewall/core/io/direct.py: use prirority for rule methods, new get_all_ methods - direct: pass priority also to client.py and firewall-cmd - applet: New blink and blink-count settings - firewall.functions: New function ppid_of_pid - applet: Check for gnome3 anxXl L0c9s$cstG 8?Pd  Clp ( T  j      7     @ lD*(^8h%9%:L%G$ HP I| XY\ ] ^t bWdeflt u v$wX x y L`d     ,g 0h 4Cperl-DB_File1.8421.el8Perl5 access to Berkeley DB version 1.xDB_File is a module which allows Perl programs to make use of the facilities provided by Berkeley DB version 1.x (if you have a newer version of DB, you will be limited to functionality provided by interface of version 1.x). The interface defined here mirrors the Berkeley DB interface closely.]build.cloudlinux.com]CloudLinuxCloudLinuxGPL+ or ArtisticCloudLinux Packaging Team Unspecifiedhttps://metacpan.org/release/DB_Filelinuxx86_64?TAk IAAAA큤]]]]]]][J%F[J0]]e378a171490e802dc4c969602f76ddcd4cd0424809fb9571e32b1590b2c6013c097cf3ec009b8a50f7e31306000bcbbe4218a7ccd44d05caf4d425902baf73f962000129d316b181c2fe5878d56f1f4d824df95c1e18db1bb9e4fae4ae144c7fcafbf6d7301e63b79c169bc52edaa3c77b53954a1b2835bb88922b5c294997befa4fca4f8a7587adc5907fc07c3ab142807d6060824283b58f222eb166540ca8d9a3b1a8df5c561bebc221c0a9fd848a046a130d646c9d60cf67df63d49c012c../../../../usr/lib64/perl5/vendor_perl/auto/DB_File/DB_File.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-DB_File-1.842-1.el8.src.rpmperl(DB_File)perl(DB_File::BTREEINFO)perl(DB_File::HASHINFO)perl(DB_File::RECNOINFO)perl-DB_Fileperl-DB_File(x86-64)@@@@@@@@@ @@@@@@    @libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdb-5.3.so()(64bit)libperl.so.5.26()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(Carp)perl(Exporter)perl(Fcntl)perl(File::Spec)perl(Tie::Hash)perl(XSLoader)perl(strict)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)5.8.33.0.4-14.6.0-14.0-15.2-14.14.2[LZlZ@Z|;Y@YyY7Y2XXj@W - 1.842-1Petr Pisar - 1.841-1Jitka Plesnikova - 1.840-398Fedora Release Engineering - 1.840-397Fedora Release Engineering - 1.840-396Fedora Release Engineering - 1.840-395Jitka Plesnikova - 1.840-394Jitka Plesnikova - 1.840-393Fedora Release Engineering - 1.840-2Petr Pisar - 1.840-1Jitka Plesnikova - 1.838-2Petr Pisar - 1.838-xq X]L،$# the manifest- ZC-9886: Add meta info to target-os profile && update EA4-production manifest when updating EA4 manifest - EA-10600: Add PHP 7.3 to EOL recommendations- ZC-9849: Add pkg_manifest.json and add target to ea_current_to_profile - ZC-9854: Add ea-nginx-njs to additional packages and recommendations.- ZC-9823: Set php default version to 8.0- ZC-9758: Add ea-nginx-brotli to additional packages list && do http2-like toggle off recommendations - ZC-9759: add `container_based_packages` list to ea4-metainfo.json- ZC-9690: Add ea-nginx-gzip to Additional Packages list- ZC-9636: Add recommends for ea-nginx-http2- ZC-9632: Add ea-nginx-http2 to EA4 `Additional Packages`- ZC-9570: Replace EOL `ea-nodejs10` w/ LTS `ea-nodejs16` in ea4-metainfo.json’s additional pkgs- ZC-9528: Add /etc/cpanel/ea4/option-flags/README.md- ZC-9307: Rolling “ea-cpanel-tools” back to “0a3c415”: ea-apache24-mod-passenger shows up under Apache modules so additional packages was not necessary- ZC-9303: Add ea-apache24-mod-passenger to additional packages list for EA4 UI- ZC-9253: install nobody hook via ea-cpanel-tools so its available for pre-txn profile install- EA-10037: Update open_basedir to have correct Changeable value in phpini_directives.yaml- ZC-9029: have post install output be clear that it was complete- ZC-8595: ZC-8595-ea-cpanel-tools: Add missing directives- EA-9612: Update default PHP to 7.4- ZC-6815: Add ea-nginx-standalone to additional_packages- ZC-7904: Add eol recommendation for ruby24 on C7 and beyond (6 only has ruby24)- EA-9444: Add PHP 7.2 to EOL recommendations- ZC-7308: Updates for PHP 8- ZC-7307: Specify default directory index and PHP FPM’s `security_limit_extensions` that so they can be updated without requiring a ULC updated/backport- ZC-7629: Add mod sec 3.0 apache connector to additonal packages list- ZC-7001: Make PHP 7.3 the default PHP- ZC-7471: Add ea-modsec30-connector-nginx to ea4-metainfo.json’s additional_packages- ZC-7463: Add ea-modsec30-rules-owasp-crs to ea4-metainfo.json’s additional_packages- ZC-7320: Add `ea-modsec2-rules-owasp-crs` to the additional packages list- ZC-6837: Build on CentOS 8- ZC-4935: Add recommendation for -php-cli and -php-common removal- EA-8960: Update end-of-life PHP phrase- EA-8930: Update max_execution_time default to 30- ZC-5894: Move PHP.ini directive data to RPM- EA-8784: Add PHP 7.1 to EOL recommendations- ZC-5740: Add yum var ea4_repo_uri_os- ZC-4963: Add `ea-nginx` to Affition Packages list- CPANEL-26711: ea_current_to_profile should use a prefix like ea_install_profile- EA-8200: Add --firstinstall flag to ea_install_profile- ZC-4650: Add ea4-metainfo.json file- ZC-4595: add PHP 5.6 and 7.0 EOL recommendations, add `filter` to recommendations hash- EA-7549: If the php config file is a symlink, and the force option is used, remove the symlink so the file can be written.- EA-7173: Add recommendation for EOL PHPs- EA-6344: ea_convert_php_ini fixups: add missing require, allow it to parse suphp conf handlers, add usage comment to package- ZC-2606: no longer treat local.ini as special- ZC-2563: Add a --all-users flag- ZC-2549: Add ea_sync_user_phpini_settings script- EA-6101: Rephrased description in PHP DSO recommendation.- EA-6025: Add top level 'level' and adjust options' 'level' of PHP DSO recommendation- EA-6021: revamp EA4 Recommendations data for new spec- EA-5964: add initial EA4 Recommendations data- Added vendor field (EA-5493)- EA-5320: filter out profile packages that do not exist on the server- EA-5065: Have ea_install_profile to use new resolution method if it can- Added ea_convert_php_ini script (EA-4772) - Updated rpm spec file to conform to standard macros - Fixed several rpmlint errors- EA-4383: Update Release value to OBS-proof versioning- Give some indication that package resolution is happening and may take a bit- Use the 'ea' namespace in the resolve_multi_op call.- Changed name of the rpm to ea-cpanel-tools- Initial Commithou-2 1779908982xXnLh$F-?(d + T 06@ d  v        H l   R(8F9F:FF"G" H" I# X# Y#8\# ]# ^$rb%c&dd&e&f&l&t& u& v' z(P(`(d(j(((* * ----p-t -g-h-Cea-php74-php-pgsql7.4.3318.24.7.cpanelEOL A PostgreSQL database module for PHPphp 7.4 has reached End of Life. The ea-php74-php-pgsql package add PostgreSQL database support to PHP. PostgreSQL is an object-relational database management system that supports almost all SQL constructs. PHP is an HTML-embedded scripting language. If you need back-end support for PostgreSQL, you should install this package in addition to the main php package.jhou-1EA4-production / CentOS_8cPanel, Inc.PHPDevelopment/Languageshttps://endoflife.date/phplinuxx86_643;NCGAAAjmjmjjjjjjjba9ac133e58220ffeabbd5b15ba305c51ce9e408471a5d3eda1d0236fa5293e0ae264c1c89b1190d7515e1a528d978f112e19dfb1f35a566fbafb722467c78ed095778d688638afb813e2ed576539bf471f177acbd26e4fc1201426d05961e4820ab3292702738c7920753723cf6020c88c6f56fcbd4a488b48bd885890cb411../../../../opt/cpanel/ea-php74/root/usr/lib64/php/modules/pgsql.so../../../../opt/cpanel/ea-php74/root/usr/lib64/php/modules/pdo_pgsql.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootea-php74-php-7.4.33-18.24.7.cpanel.src.rpmconfig(ea-php74-php-pgsql)ea-php74-php-pdo_pgsqlea-php74-php-pdo_pgsql(x86-64)ea-php74-php-pgsqlea-php74-php-pgsql(x86-64)ea-php74-php_database@@@@@@@    @config(ea-php74-php-pgsql)ea-php74-php-pdo(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpq.so.5()(64bit)libpq.so.5(RHPG_9.6)(64bit)opensslrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel3.0.4-14.6.0-14.0-15.2-14.14.3iC@id@hgv@g@g~hg@fo@f@e4@ehy@eddu@dbd,@c@cs@cc@c5bbX b\@b@b[@ada@aa{a@@a@as@a]aV@aMa'@a@`ݮ@`ٹ``@`@`B@`@`__0@_Í@_@_F@__]@_"_u_R,@_P_+_@_^^n@^@^x^2^@^1^H^|@^f/^:@^Brian Mendoza - 7.4.33-18Gary Stanley - 7.4.33-17Chris Castillo - 7.4.33-16Cory McIntire - 7.4.33-15Dan Muey - 7.4.33-14Dan Muey - 7.4.33-13Julian Brown - 7.4.33-12Dan Muey - 7.4.33-11Julian Brown - 7.4.33-10Travis Holloway - 7.4.33-9Tim Mullin - 7.4.33-8Dan Muey - 7.4.33-7Travis Holloway - 7.4.33-6Julian Brown - 7.4.33-5Julian Brown = 2.6.30 from Thomas Liu. * Re-enable disable_dontaudit rules upon semodule -B from Christopher Pardy and Dan Walsh. * setfiles converted to fts from Thomas Liu.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- fix multiple directory ownership of mandirs- Update to upstream * Keep setfiles from spamming console from Dan Walsh. * Fix chcat's category expansion for users from Dan Walsh. - Update po files - Fix sepolgen- Add sepolgen executable- Fix Sandbox option handling - Fix fixfiles handling of btrfs- Fix sandbox to be able to execute files in homedir- Change polgen.py to be able to generate policy- Update to upstream * Fix transaction checking from Dan Walsh. * Make fixfiles -R (for rpm) recursive. * Make semanage permissive clean up after itself from Dan Walsh. * add /root/.ssh/* to restorecond.conf- Fix audit2allow -a to retun /var/log/messages- Run restorecond as a user service- Add semanage module support- Do not print \n, if count < 1000;- Handle case where subs file does not exist- Update po files - Add --equiv command for semanage- Cleanup creation of permissive domains - Update po files- Update po files- Fix semanage transations- Update polgengui templates to match current upstream policy- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Add /root/.ssh to restorecond.conf - fixfiles -R package should recursively fix files- Update to upstream * Add btrfs to fixfiles from Dan Walsh. * Remove restorecond error for matching globs with multiple hard links and fix some error messages from Dan Walsh. * Make removing a non-existant module a warning rather than an error from Dan Walsh. * Man page fixes from Dan Walsh.- Fix script created by polgengui to not refer to selinux-policy-devel- Change initc scripts to use proper labeling on gui- Add obsoletes to cause policycoreuils to update both python and non python version- Dont report errors on glob match and multiple links- Move sepolgen-ifgen to post python- Fix Translations- Add Domains Page to system-config-selinux - Add ability to create dbus confined applications to polgen- SxXp L@9_A$O_A`AG9?5d  @ FR   P   (xhk(859 t5:5G-lH-I-X-Y.\.$].d^/i b0_d1e1f1l1t1u2v2Tw4|x4y45h5l5r5557 7 9H9q999g9h9Clibmodulemd2.13.01.el8Module metadata manipulation libraryC Library for manipulating module metadata files. See https://github.com/fedora-modularity/libmodulemd/blob/master/README.md for more details.a`192-168-251-21.atm.cloudlinux.com AlmaLinuxAlmaLinuxMITAlmaLinux Packaging Team Unspecifiedhttps://github.com/fedora-modularity/libmodulemdlinuxx86_64c&+8 2>M AAAA큤A큤A큤a`ua`a`a`a`a`a`Xa`Oa`Xa`ua```a``a`N9d9507040eb365dc689ae7343f3df8e8148bba56c340acd302de5fab20a562d4b2efe05bbd9a1fccb5399815baa12ae9fb7f5776b30ea63517abda946089f4a07760a7b9bb91b47f8b357b64725b34365eba93b9df8397cb9101a0d6c054a01ac618a41d8eca61de2a0ffbf30e3b737911129b93e87ea35b424f5adc1424f5905c2c16df11a70ee92d26445c9b01540f3dd1744bc93e0daff77e9e9a20bcfe2e40afccd95484d483800c17dd18a734518ba36e832841579a1f21dc94fb73bbdfa6ea1a9d18d8057726215a68ddf019aee703dfe501d94a4ff2c69fb56d345cb9../../../../usr/bin/modulemd-validator../../../../usr/lib64/libmodulemd.so.2.13.0libmodulemd.so.2.13.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibmodulemd-2.13.0-1.el8.src.rpmlibmodulemdlibmodulemd(x86-64)libmodulemd.so.2()(64bit)@@@@@@@@@@@@@@@    @libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libmagic.so.1()(64bit)libmodulemd.so.2()(64bit)librpmio.so.8()(64bit)libyaml-0.so.2()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3`:@`^])]@\t@\9\\@\A\?\I\I\I\\U@[l,[i[dC[Q[O+[H@[.6@[,[(@['['Z@ZmZmZԐ@ZЛZľ@Z@Z@Z`@Z`@ZZ@ZH@Z@ZZv@Zv@ZyZyZtRZOhYYYχ@Y@Y@YPetr Pisar - 2.13.0-1Petr Pisar - 2.12.1-1Stephen Gallagher - 2.9.4-2Stephen Gallagher - 2.8.2-1Stephen Gallagher - 2.5.0-4Stephen Gallagher - 2.5.0-2Stephen Gallagher - 2.5.0-1Stephen Gallagher - 2.4.0-1Stephen Gallagher - 2.0.0-5Stephen Gallagher - 2.0.0-4Stephen Gallagher - 2.1.40-1Fedora Release Engineering - 2.1.39-2Ville Skyttä - 2.1.39-1Fedora Release Engineering - 2.1.38-2Ville Skyttä - 2.1.38-1Ville Skyttä - 2.1.37-1Ville Skyttä - 2.1.36-1Fedora Release Engineering - 2.1.35-3Ville Skyttä - 2.1.35-2Ville Skyttä - 2.1.35-1Ville Skyttä - 2.1.34-1Ville Skyttä - 2.1.33-1Ville Skyttä - 2.1.32-1Ville Skyttä - 2.1.31-1Ville Skyttä - 2.1.30-1Fedora Release Engineering - 2.1.29-3Fedora Release Engineering - 2.1.29-2Miroslav Lichvar 2.1.29-1Miroslav Lichvar 2.1.28-1Miroslav Lichvar 2.1.27-1Miroslav Lichvar 2.1.26-1Miroslav Lichvar 2.1.25-1Miroslav Lichvar 2.1.24-1Miroslav Lichvar 2.1.23-1Miroslav Lichvar 2.1.22-1Miroslav Lichvar 2.1.21-1Jesse Keating - 2.1.20-1.1Miroslav Lichvar 2.1.20-1Jesse Keating Bill Nottingham 2.1.19-1Bill Nottingham 2.1.18-1Bill Nottingham 2.1.17-1Bill Nottingham 2.1.16-1Bill Nottingham 2.1.15-1Bill Nottingham 2.1.14-1Bill Nottingham 2.1.13-1Bill Nottingham 2.1.12-1Jens Petersen 2.1.11-1Nalin Dahyabhai 2.1.10-1Bill Nottingham 2.1.9-1Nalin Dahyabhai 2.1.8-1Bill Nottingham 2.1.7-1Bill Nottingham Bill Nottingham Tim Waugh 2.1.4-2Bill Nottingham Bill Nottingham Bill Nottingham Than Ngo Preston Brown Bill Nottingham Bill Nottingham Bill Nottingham Bill Nottingham Bill Nottingham Jeff Johnson Bill Nottingham Preston Brown Matt Wilson Bill Nottingham Cristian Gafton Bill Nottingham Jeff Johnson Prospector System Donnie Barnes Erik Troan - Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Update to 2.1.48- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Update to 2.1.47- Add build requirement for perl- Update to 2.1.46- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Update to 2.1.45 - Output nginx-mimetypes subpackage- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Update to 2.1.44- Update to 2.1.43 - Mark COPYING as %license- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Update to 2.1.42.- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Update to 2.1.41. - Fix bogus dates in %changelog.- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Update to 2.1.40.- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Update to 2.1.39.- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to 2.1.38.- Update to 2.1.37.- Update to 2.1.36.- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Fix URL tag (#659210, Matt McCutchenxXX cLs$csrt44) - Add new attribute for Package - from_repo - Change behaviour of Package().from_repo - Package: add a get_header() method- yum.misc.decompress() to handle uncompressed files (RhBug:1895059) - Module switch command- Fix patch for dnf history operations- `dnf history` operations that work with comps correctly - Remove sourcepackages from install/upgrade set - Fix documentation of globs not supporting curly brackets- Backport patches - Log scriptlets output also for API users (RhBug:1847340) - Post transaction summary is logged for API users (RhBug:1855158)- Backport patch Revert "Fix --setopt=cachedir writing outside of installroot"- Update to 4.4.2 - spec: Fix building with new cmake macros (backport from downstream) - Warn about key retrieval over http: - Fix --setopt=cachedir writing outside of installroot - Add vendor to dnf API (RhBug:1876561) - Add allow_vendor_change option (RhBug:1788371) (RhBug:1788371)- Update translations- Add logfilelevel configuration (RhBug:1802074) - [doc] Enhance repo variables documentation (RhBug:1848161,1848615)- Handle empty comps group name (RhBug:1826198)- Update to 4.2.23 - Fix behavior of `install-n` command - Fix behavior of `localinstall` command - Fix behavior of `autoremove-n` command - Fix behavior of `remove-n` command - Fix behavior of `repoquery-n` command - Fix behavior of `list-updateinfo` and related aliases - Refactor code in `repoinfo` to use opts.command correctly. - Add myself to list of contributors - Add updated to verbose output of updateinfo list (RhBug: 1801092) - Fix a couple of missed grammatical errors in updateinfo docs. - Add comment option (RhBug:1773679) - Better wording of dnssec email parsing error. - Print nicer DnssecErrors (RhBug:1813244) - Add new API for handling gpg signatures (RhBug:1339617) - Verify GPG signatures (RhBug:1793298) - Fix a syntax typo - Fix up Conflicts: on python-dnf-plugins-extras so it actually works - [doc] Move yum-plugin-post-transaction-actions to dnf-plugins-core - Remove args "--set-enabled", "--set-disabled" from DNF (RhBug:1727882) - Search command is now alphabetical (RhBug:1811802) - Fix downloading packages with full URL as their location - repo: catch libdnf.error.Error in addition to RuntimeError in load() (RhBug:1788182) - History tbl to max size when redirect to file (RhBug:1786335,1786316)- Update to 4.2.21 - Running with tsflags=test doesn't update log files - Allow disabling individual aliases config files (RhBug:1680566) - List arguments: only first empty value is used (RhBug:1788154) - Report missing profiles or default as broken module (RhBug:1790967) - Format history table to use actual terminal width (RhBug:1786316) - Handle custom exceptions from libdnf - Fix _skipped_packages to return only skipped (RhBug:1774617) - Add setter for tsi.reason - Add new hook for commands: Run_resolved - Clean also .yaml repository metadata - Use WantedBy=timers.target for all dnf timers (RhBug:1798475) - Fix completion helper if solv files not in roon cache (RhBug:1714376) - Add bash completion for 'dnf module' (RhBug:1565614) - Check command no longer reports missing %pre and %post deps (RhBug:1543449) - Check if arguments can be encoded in 'utf-8' - Fix crash with "dnf -d 6 repolist" (RhBug:1812682) - Do not print the first empty line for repoinfo - Redirect logger and repo download progress when --verbose - Respect repo priority when listing packages (RhBug:1800342) - Remove misleading green color from the "broken dependencies" lines (RhBug:1814192) - [repoquery] Fix rich deps matching by using provide expansion from libdnf (RhBug:1534123) - [repoquery] Do not protect running kernel for --unsafisfied (RhBug:1750745) - [doc] Document the retries config option only works for packages (RhBug:1783041) - [doc] repoquery --what* with multiple arguments (RhBug:1790262) - [doc] Remove incorrect information about includepkgs (RhBug:1813460) - [doc] Document that list and info commands respect repo priority - [doc] Document color options- Sort packages in transaction output by nevra (xXsLzpbO$rbOcOaOe402ce70adf1164f65bd344505380acdae67345fe8cf4d9a9d94df35932640729514addfe29c93ec839fa2d0f61742dff0413555af28166d4df89260972f457ecde68d3f68a74558a8acf180c97a718400f61fcfabe59819b7894f1a1beed602fb4830117b7c8cf8d2089e091c4a6935a83d0dad6647d916b1e7173022c9431ef13edf27c73d0ad5656dfdb37bbb56edc0aefdaf4429b9688084e50ffd2df4d35c153f19589e069dc4a4871f85511b368e7a46866f16e93e923f317ba41a7b30c2464062e33325dd38b0e1d98023870653358d6e277c6e5b1ab8c6a7d430862e56bf27e6c39eb4174a334cd925defb0f2d6ce633b448efeb529b7e79603f61142a83b3fb84a4592153e533fbd9c3700b03cdb841a8aa14c840b596be4c944b2df106790a2a4c31117d56dd29c6d5ed81866b9d0236584b301766262eef2c07cd79380781fcf7090778ed7aa776803ec6e43a596443234ec620ebf35c8826784741caa75cb81ea4663f0e480dbaeb4a8d9a10087f26dda8bd62bf19c8724e873cbfab36ad4e72c1460c15ec242678b1e980247f19e0ab6f095efb5e54af26c1aafe56c5d26a7a4480966a9e212b741f7a8ee43fd2c80e6882383d12b7e69cc90b0b7e65216bb497177849f05e2879092ad47a056533b31704013bfb017b9413a7d501cbbf1a96f5dad9a583d119ae5500e091f80b8a2e2edc21e0f5e6574da8d35951c5f5adb54a0b4e0bec042d67d339cb7c9e3bd986c5af61762d64728b171d8cc64465bff5508173c6079215f0b52110a73d6d7d257d8a94f634e588a15390546b6f7a7f83e1d302421859be0519e6ec754b91e3b5bff71c4485184235f7951af6ba5859d6a99b207c61cdb26d45e992f5b04d317482f47e730ba5c7c2b38fc0737ea6c927d323c95e9885fbc5a3f6a35fefc4f0dcf9e02ea75bd50d0417b45725a50b7152733c176f5ed8ba395f31ef071d68e46de9997ff7d37829a92dc4892cd3ec64e2642bf3bee32143436d94b3cd3c3d79946571be8784ed77a818b6c0d3e09ae173d0cc6c8a60b0a25ba68eaa93fdf9c357667ea831983df128e041859ad8207cced90f8c3361a7b49ac4a0610b40de5191decc4988c9aa0dd18a1c79c91e9c18f86465a731b03157f68d1ecd76236f5686b327bb175eb0de8e74a744c995ad58519dbbeb8dccc2dd145807d007ac9d3dbc46f808c1fcc8c0d58bb6517e1e04f01fd402dbd39dd6c60ef184a4232e2a22f5ab292b8ff6a502a31e3a0ba0e028fe3e4e0ffd63ec4304b2c4492d85c3f1a05aad4a1269736357e1675aa66dcd2de9f218437ed4f968b49cc4ab520586f4a24208aa1c833f3c1fb33e6ad054b368788a3638c5cfc4f2da4c8fdfe05f5d542f14c17080eca24dd328afb4f882f8d3e2c0aa10ab35b0702a7e06bdb784a0f97cba8c04488246832b24ddb03afb25cd41f5eb3461e83309da3464d25a706d64901dc4bb1e51ae4e930979b368e91f4d7f0ac3af3efc2d9039a1a8323e87206a902776f6f014a5ed2c560d17f4dfe2f5a74ddb0425f412ce272b1b78c4551f7fff3bfdc7e3cd3f6dc3b589a7d003d7883d13ebbef5479f0104e4b1fa17b6964386afbe463732e509b3d3e3b07c5b471bb963ed1e3b840021d5bba97d39dcbeb54e6a47b665959230a48b87e7a04e84281c9ae63d907780fa3efcf2ec4f20098352519698b3051774e2e1a15d03a8dd7e602fd83c6bc21bbfc2170219e5bbe4d3a814292acb6f02b2e2c21ad262d60219789c370a7afc1ebed92fc08c86aa6792f305a0c9f6dcaef3eace87a52edf97c381c1b355ed0a3010c9030b76576d23b6491c25cf684dfb8ff2af66c70bcc466f0ba0cc7a3055db10f32dc77e37b99afd8da0ad0b295e09f1fb514f43616afdf43648eda5cdc7bccdecc2b01ea3bd0f1597a3e9ca919941cfb6efbf1ab1bc76f00093e2c55d0cbf40ea3d09042c735b38c4c3325f5f05d144ecf294d8a369a960cbe326dbfddbcc6dc9bdea28115b5e8897de7a6eeb3af826066e64698ebbe49a17ab0de849574206f08fca96ee37e470b73f0c99ce2973be4d419b19bc231dc009253c580f164f230b3d323608f57056f1f68b3edf0383dcc5b0b1360af813f5e4f8c2e849065294dceb34689e3108263b3767efb35b7ef61b563ab35cb3bd96bf63f297dcc4c4af2df3717c69c2f0f87f7d2434f7e29418f81d78251004698cb29d547021dd1917e2eb2e719c86abb4a40d543f6f8196e5beb825796207e813a9ba7450336f906ebd2534efe423d0c2258cb3187efb789af7a0d1c0c59382dbf1863b009b91d8c3111b6b15390f42a2cf62fc372ab19105b026c21cc3e5e7490b410e652e10374d64d3133b3457165a77cf89e9e813ec979459aa1ccec731b245f28b6668416224a2e4444593316c55858687a285ed1949201e900264af776a985ceb5c9a71d622fffd2ef5e6937bc41be2419bf0f1f14649e34714d2a7a53d0e4c369c954dfb7713a6aef1fc3795d90ca7b7ed882f72c63a968c4b7f085f178b7657be127d22acd8bb576e6e934835fe779648714c8d1cea92e5f5750ec89fcde647c1fce2566edb8664b5edc8a3ea348cbea48d26cb862e5706fe44344966821b896e9e8e99c23df3afbcf9c0e892575e4f9f2088e82cacf898b53e386ee98029a43fe1813ffc37f795b05443f981b2b8a67de6b800dbbe3f6cbf85c36a7954c387e1b9b9a97b87affc91c9124f5eab8f18bec713ecdd0ea219c1e3458cba2e10368d045a7e78da8660e5ffac26c26128b9c60062ff2eed58d0ee09a67ebea26ae6ff5878ef1fa2d4b7f1fff5f30x:XtLm $?box window size * sandbox: check for paths up front * sandbox: use defined values for paths rather * sandbox: move seunshare globals to the top * sandbox: whitespace fix * semodule_package: Add semodule_unpackage executable * setfiles: get rid of some stupid globals * setfiles: move exclude_non_seclabel_mounts to a generic location * sepolgen * refparser: include open among valid permissions * refparser: add support for filename_trans rules- Fix bug in glob handling for restorecon-Update to upstream 2.1.4 2011-08-17 * run_init: clarification of the usage in the * semanage: fix usage header around booleans * semanage: remove useless empty lines * semanage: update man page with new examples * semanage: update usage text * semanage: introduce file context equivalencies * semanage: enable and disable modules * semanage: output all local modifications * semanage: introduce extraction of local configuration * semanage: cleanup error on invalid operation * semanage: handle being called with no arguments * semanage: return sooner to save CPU time * semanage: surround getopt with try/except * semanage: use define/raise instead of lots of * semanage: some options are only valid for * semanage: introduce better deleteall support * semanage: do not allow spaces in file * semanage: distinguish between builtin and local permissive * semanage: centralized ip node handling * setfiles: make the restore function exclude() non-static * setfiles: use glob to handle ~ and * fixfiles: do not hard code types * fixfiles: stop trying to be smart about * fixfiles: use new kernel seclabel option * fixfiles: pipe everything to cat before sending * fixfiles: introduce /etc/selinux/fixfiles_exclude_dirs * semodule: support for alternative root paths 2.1.3 2011-08-03 * semanage: fix indention * semodule_package: fix man page typo * semodule_expand: update man page with -a * semanage: handle os errors * semanage: fix traceback with bad options * semanage: show usage on -h or --help * semanage: introduce more deleteall options * semanage: verify ports < 65536 * transaction into semanageRecords * make get_handle a method of semanageRecords * remove a needless blank line * make process_one error if not initialized correctly * fixfiles: correct usage for r_opts.rootpath * put -p in help for restorecon and * fixfiles: do not try to only label * fixfiles clean up /var/run and /var/lib/debug * fixfiles delete tmp sockets and pipes rather * fixfile use find -delete instead of pipe * chcat man page typo * add man page for genhomedircon * setfiles fix typo * setsebool should inform users they need to * setsebool typos * open_init_tty man page typos * Don't add user site directory to sys.path * newrole retain CAP_SETPCAP 2.1.2 2011-08-02 * seunshare: define _GNU_SOURCE earlier * make ignore_enoent do something * restorecond: first user logged in is not noticed * Repo: update .gitignore 2.1.1 2011-08-01 * Man page updates * restorecon fix for bad inotify assumptions 2.1.0 2011-07-27 * Release, minor version bump- Fix sepolgen usage statement - Stop using -k insandbox - Fix seunshare usage statement- Change seunshare to send kill signals to the childs session. - Also add signal handler to catch sigint, so if user enters ctrl-C sandbox will shutdown.- Add -k qualifier to seunshare to have it attempt to kill all processes with the matching MCS label.- Add -C option to sandbox and seunshare to maintain capabilities, otherwise the bounding set will be dropped. - Change --cgroups short namexXrL}$ Gnatenko) - configurable maximum number of parallel downloads (RhBug:1230975) (Igor Gnatenko) - add info to bash_completion (1nsan3) - dnf upgrade does not try to upgrade uninstalled packages (RhBug: 1234763) (Adam Salih) - dnf group list now checks every package and prints out only invalid ones (Adam Salih) - install: return zero exit code if group is already installed (RhBug:1232815) (Michal Luscon) - doc: add -b which does the same as --best (Igor Gnatenko) - support category groups (Michael Mraka) - cli test update for repofrompath (Michael Mraka) - documentation for --repofrompath (Michael Mraka) - implemented --repofrompath option (RhBug:1113384) (Michael Mraka) - doc: document filter provides and obsoletes (Michal Luscon) - doc: extend --quiet explanation (RhBug:1133979) (Jan Silhan) - fixed dnf-automatic email emitter unicode error (RhBug:1238958) (Jan Silhan) - doc: be specific what 'available' means in list/info (Jan Silhan) - cosmetic: fixed typo (RhBug:1238252) (Jan Silhan) - groups: clean dependencies (Michal Luscon) - groups: fix removing of env that contains previously removed group (Michal Luscon) - groups: fix removing of empty group (Michal Luscon) - AUTHORS: updated (Jan Silhan) - bash-completion: ignore sqlite3 user configuration (Peter Simonyi) - Fix package name for rawhide .repo files (Frank Dana) - Add 'transaction_display' to DemandSheet (Will Woods) - translation: update (Jan Silhan) - translation: use zanata instead of transifex (Jan Silhan) - Updated Polish translation (Piotr Drąg) - updated georgian translation (George Machitidze) - group: fixed installing of already installed environment (Jan Silhan) - conf: change minrate threshold to librepo default (RhBug:1212320) (Michal Luscon)- conf: change minrate threshold to librepo default (RhBug:1212320) - group: fixed installation of already installed environments- doc: document variables in repo conf (Michal Luscon) - groups: temporary fix for group remove (RhBug:1214968) (Michal Luscon) - group: print summary of marked groups / environments together at the end (Jan Silhan) - group: fixed marking as installed (RhBug:1222694) (Jan Silhan) - doc: Spelling fixes (Ville Skyttä) - dnf-automatic: Fix systemd service description (thanks Ville Skyttä) (Jan Silhan) - doc: assumeyes added to Base.conf and config option (Jan Silhan) - optionparser: deleted --obsoletes option that conflicted with repoquery plugin (Jan Silhan) - dnf-automatic: Document emit_via default (Ville Skyttä) - man: yum2dnf don;t show content (RhBug:1225246) (Thanks Adam Salih) (Jan Silhan) - doc: allowed chars of repo ID (Jan Silhan) - doc: minimal repo config file (Jan Silhan) - doc: configuration files replacement policy (Jan Silhan) - fixed typo in man page (RhBug:1225168) (Michael Mraka) - Update authors (Michal Luscon) - dnf-automatic: add random_sleep option (RhBug:1213985) (Vladan Kudlac) - don't print bug report statement when rpmdb is corrupted (Related:RhBug:1225277) (Jan Silhan) - comps: fix unicode issue (RhBug:1223932) (Thanks Parag) (Parag Nemade) - logging: setup librepo log in verbose mode (Michal Luscon) - doc: document the versioning scheme (Radek Holy) - groups: end up empty group removal before solving (Michal Luscon) - groups: end up empty installation before solving (RhBug:1223614) (Michal Luscon) - doc: add support for transactions/packages/ranges in "dnf history list" (Radek Holy) - doc: add support for transaction ranges in "dnf history info" (Radek Holy) - support ssl client certificates (RhBug:1203661) (Michael Mraka) - doc: document the "mirrorlist" configuration option (Radek Holy) - doc: document the "metalink" configuration option (Radek Holy) - doc: document the "baseurl" configuration option (Radek Holy) - doc: document the "enabled" configuration option (Radek Holy) - doc: document the "name" configuration option (Radek Holy) - Revert "spec: added sqlite requirement" (Jan Silhan) - spec: added sqlite requirement (Jan Silhan) - cosmetic: fixed typo in comment (Jan Silhan) - man: added referxhxXvLP$P NP://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Updated to 1.6.4 full release, patch to allow missing ipsechook - Resolves rhbz#1465575 unbound fails to start up, complains about missing ipsecmod-hook- Update to 1.6.4 (esubnet, ipsecmod support, bugfixes)- Updated to 1.6.3 (fixes assertion failure when receiving malformed packet with 0x20 enabled)- Patch for cmd: unbound-control set_option val-permissive-mode: yes- Update to 1.6.2 (rhbz#1425649) - Updated unbound.conf with new options- Call make unbound-event-install to install unbound-event.h- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Remove obsoleted DLV key- Actually remove dependency because minimum is always satisfied- Depend on openssl-libs, not opensl- Update to 1.6.0- Rebuild for Python 3.6- Bugfix building without python2 and python3 - Fixup streamtcp build (Paul)- Updated to 1.5.10 (better TCP handling, bugfixes) - Install pkgconfig file in -devel package - Updated unbound.conf- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Fix upper port range to 60999 because that's what selinux allows- Patch for allowing more queries before failure (needed for query minimalization)- Updated to 1.5.9- Fix streamtcp to link against libpython3.x instead of libpython2.x- Update to 1.5.8 (rhbz#1313831) which incorporates rhbz#1294339 patch - Updated unbound.conf with new upstream options - Enabled ip-transparent: yes (see rhbz#1291449)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Fix escaping of shell chars in unbound-control-setup (#1294339)- Update to 1.5.7 - Enable query minimalization for enhanced DNS query privacy - Enable nxdomain hardening to assist with query minimalization and SBLs - Updated default unbound.conf for new features from upstream.- Update to 1.5.6 (#1176729)- Rebuilt for Python3.5 rebuild- New upstream release 1.5.5 (#1269137) - Removed the anchor update from %post section of -libs subpackage (#1269137#c2)- Removed dependency and ordering on unbound-anchor.service in unbound.service- Prefer Python3 build over Python2 build for now (#1254566)- Added ExecReload section to unbound.service (#1195785) - Removed After syslog.target since it is not needed any more- Start unbound-anchor.timer only on new installations - Rename root.anchor to root.key in %post section- Update to 1.5.4 - Removed patches merged into upstream- Revert: Use low maximum negative cache TTL (5 sec) (#1229596)- Add option for maximum negative cache TTL (#1229599) - Use low maximum negative cache TTL (5 sec) (#1229596)- Removed usage of DLV from the default configuration (#1223363)- unbound.service now Wants unbound-anchor.timer - unbound-anchor man page moved to the unbound-libs- Fixup scriptlets causing systemctl: command not found - Resolves rhbz#1219587 Error in PREIN scriptlet in rpm package unbound-libs- migrate cronjob to systemd timer unit (#1177285) - change the period for unbound-anchor from monthly to daily (#1180267) - Thanks to Tomasz Torcz for the initial patch- Fix FTBFS (#1206129) - Build python3-unbound and python-unbound bindings for Python 3 and 2 (#1188080)- Updated to 1.5.3 which is a bugfix on 1.5.2 for sighup handling - Updated to 1.5.2 which fixes DNSSEC validation with different trust anchors upstream, local-zone has a new keyword 'inform'- Build with --enable-ecdsa- Fix post to create root.anchor, not root.key, to match cron job- Change systemd-units to systemd - Use _tmpfilesdir macro, don't mark tmpfiles as config- Update to 1.5.1 for CVE-2014-8602 (rhbz#1172066) - Removed unbound-aarch64.patch which was merged upstream - Don't require autotools for non snapshots or run autoreconf- update to 1.5.1rc1- fix build on aarch64- Fix race condition in arc4random (#1166878)- update to 1.5.0- Resolves: #1115489 - build with python 3.x for fedora >= 22- Rebuild for rpm bug 1131960- Rebuilt for https://fedoraprojxgXwL9$/999KDCs have a better chance of being able to issue tickets with session keys of types that the client can use (#837855)- cut down the number of times we load SELinux labeling configuration from a minimum of two times to actually one (more of #845125)- backport patch to disable replay detection in krb5_verify_init_creds() while reading the AP-REQ that's generated in the same function (RT#7229)- undo rename from krb5-pkinit-openssl to krb5-pkinit on EL6 - version the Obsoletes: on the krb5-pkinit-openssl to krb5-pkinit rename - reintroduce the init scripts for non-systemd releases - forward-port %{?_rawbuild} annotations from EL6 packaging- update to 1.10.3, rolling in the fixes from MITKRB5-SA-2012-001- selinux: hang on to the list of selinux contexts, freeing and reloading it only when the file we read it from is modified, freeing it when the shared library is being unloaded (#845125)- go back to not messing with library file paths on Fedora 17: it breaks file path dependencies in other packages, and since Fedora 17 is already released, breaking that is our fault- add upstream patch to fix freeing an uninitialized pointer and dereferencing another uninitialized pointer in the KDC (MITKRB5-SA-2012-001, CVE-2012-1014 and CVE-2012-1015, #844779 and #844777) - fix a thinko in whether or not we mess around with devel .so symlinks on systems without a separate /usr (sbose)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- backport a fix to allow a PKINIT client to handle SignedData from a KDC that's signed with a certificate that isn't in the SignedData, but which is available as an anchor or intermediate on the client (RT#7183)- back out this labeling change (dwalsh): - when building the new label for a file we're about to create, also mix in the current range, in addition to the current user- update to 1.10.2 - when building the new label for a file we're about to create, also mix in the current range, in addition to the current user - also package the PDF format admin, user, and install guides - drop some PDFs that no longer get built right - add a backport of Stef's patch to set the client's list of supported enctypes to match the types of keys that we have when we are using a keytab to try to get initial credentials, so that a KDC won't send us an AS reply that we can't encrypt (RT#2131, #748528) - don't shuffle around any shared libraries on releases with no-separate-/usr, since /usr/lib is the same place as /lib - add explicit buildrequires: on 'hostname', for the tests, on systems where it's in its own package, and require net-tools, which used to provide the command, everywhere- skip the setfscreatecon() if fopen() is passed "rb" as the open mode (part of #819115)- have -server require /usr/share/dict/words, which we set as the default dict_file in kdc.conf (#817089)- change back dns_lookup_kdc to the default setting (Stef Walter, #805318) - comment out example.com examples in default krb5.conf (Stef Walter, #805320)- update to 1.10.1 - drop the KDC crash fix - drop the KDC lookaside cache fix - drop the fix for kadmind RPC ACLs (CVE-2012-1012)- when removing -workstation, remove our files from the info index while the file is still there, in %preun, rather than %postun, and use the compressed file's name (#801035)- Fix string RPC ACLs (RT#7093); CVE-2012-1012- Add upstream lookaside cache behavior fix (RT#7082)- add patch to accept keytab entries with vno==0 as matches when we're searching for an entry with a specific name/kvno (#230382/#782211,RT#3349)- update to 1.10 final- Add upstream crashfix patch (RT#7081)- update to beta 1- mktemp was long obsoleted by coreutils- modify the deltat grammar to also tell gcc (4.7) to suppress "maybe-uninitialized" warnings in addition to the "uninitialized" warnings it's already being told to suppress (RT#7080)- update to alpha 2 - drop a couple of patches which were integrated for alpha 2- pull in patch for RT#7046: tag a ccache containing xXWXxlLpu|$l|{} Mracek) - Add usage for add_new_repo() with repofrompath option (Jaroslav Mracek) - Add new API add_new_repo() in RepoDict() (RhBug:1427132) (Jaroslav Mracek) - docs: adds documentation for dnf-automatic's Command and CommandEmail emitters. (rhn) - docs: fixes typo in section description in automatic (rhn) - Adds new emitters for dnf-automatic. (rhn) - po: update translations (Igor Gnatenko) - Ensure that callback will not kill dnf transaction (Jaroslav Mracek) - Ensure that name will be not requested on None (RhBug:1397047) (Jaroslav Mracek) - Python 3.6 invalid escape sequence deprecation fix (Ville Skyttä) - display severity information in updateinfo (#741) (Michael Mraka) - po: update translations (Igor Gnatenko) - Add --nodocs option for dnf (RhBug:1379628) (Jaroslav Mracek) - Replace passive plugin noroot (Jaroslav Mracek) - Fix incorrect formating of string for logger.info (Jaroslav Mracek) - Not print help if empty line in script for shell command (Jaroslav Mracek) - Run fill_sack after all repos have changed status (Jaroslav Mracek) - Remove Hawkey object from repo if rerun of dnf.fill_sack (Jaroslav Mracek) - util/on_metered_connection: be more polite to failures (Igor Gnatenko) - cosmetic: i18n: rewording of 'Login user' (RhBug:1424939) (Jan Silhan) - Fix problem with --whatprovides in repoquery (RhBug:1396992) (Jaroslav Mracek) - Add -a and --all option for repoquery (RhBug:1412970) (Jaroslav Mracek) - Change camel-case of output of grouplist (Jaroslav Mracek) - Minor correction in release notes (Jaroslav Mracek) - Minor correction in release notes (Jaroslav Mracek)- bump version to 2.1.0 + update release notes (Jaroslav Mracek) - Fix problem with --recent option in repoquery (Jaroslav Mracek) - Fix problem with duplicated --obsoletes (RhBug:1421835) (Jaroslav Mracek) - Python 3.6 invalid escape sequence deprecation fixes (Ville Skyttä) - Add --repoid as alias for --repo (Jaroslav Mracek) - introduce dnf.base.Base.update_cache() (Martin Hatina) - Try to install uninstalled packages if group installed (Jaroslav Mracek) - Enable search of provides in /usr/(s)bin (RgBug:1421618) (Jaroslav Mracek) - style: ignore E261 (Igor Gnatenko) - makecache: do not run on metered connections (RhBug:1415711) (Igor Gnatenko) - change '--disableplugins' to '--disableplugin' (Martin Hatina) - cosmetic: removed unused import (Jan Silhan) - show hint how to display why package was skipped (RhBug:1417627) (Jan Silhan) - spec: add information how to obtain archive (Igor Gnatenko) - fix messages (UX) (Jaroslav Rohel) - zanata update (Jan Silhan)- bump version to 2.0.1 + update release notes (Jaroslav Mracek) - introduce cli 'obsoletes' option (Martin Hatina) - swap tids if they are in wrong order (RhBug:1409361) (Michael Mraka) - Disable shell command recursion (Jaroslav Rohel) - Honor additional arguments for DNF shell repo list command (Jaroslav Rohel) - don't traceback when bug title is not set (Michael Mraka) - introducing list-security, info-security etc. commands (Michael Mraka) - Add lsedlar to contributors list (Lubomír Sedlář) - Return just name from Package.source_name (Lubomír Sedlář) - introduce dnf.conf.config.MainConf.exclude() (Martin Hatina) - systemd: Disable daemons on ostree-managed systems (Colin Walters) - introduced dnf.base.Base.autoremove() (RhBug:1414512) (Martin Hatina) - po: update translations (Igor Gnatenko) - build: use relative directory for translations (Igor Gnatenko) - Temporary eliminate a problem with install remove loop (Jaroslav Mracek) - Handle info message when DRPM wastes data (RhBug:1238808) (Daniel Aleksandersen) - Fix output for better translation (RhBug:1386085) (Abhijeet Kasurde) - yum layer refactored (Martin Hatina) - return values changed to match yum's (Martin Hatina) - Reword sentence after removing package (RhBug:1286553) (Abhijeet Kasurde) - Minor documentation revisions (Mark Szymanski) - Minor code fix (Abhijeet Kasurde) - automatic: email emitter date header (David Greenhouse) - Solve problem when no repo and only rpms with upgrade coxFXyL0$V00` directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=9bcfc73e25805e8fcf73e12d9667db58ef1b42db, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cbf5c264d283ca773cf24ade971714d5b2c9c216, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cf309b1dd19b276320a177a182c822bb344c7213, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1066b6defe095afc1b3dfa5f13fa5cfff33d1224, strippedASCII textC source, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) RRRRRRR R RRRRRRRRRR R RRRRRRRRRR RRRRRRRRRR https://bugz.fedoraproject.org/tcp_wrappersutf-83e91d328004d74a1f830fcf6d4548d11853c21205a54ef64e8c17f990d480974?0KP3!y덏%!E/֡_ !E/֡6egXr'j’RJz `t#VO2LNh7%v%=TZg ߷k8s(3,+(Ԝ 1q3XcoR` 2İ5u?0tÛF4^Y| 46^J,q7KٱI'cΌ>AD:H@mbhE.:BJ ߬3wÁYٺ+մ_HYW'[d(۫Sa&Mku3ރS@d^0˥!7fiJ'u߬$w hϰ> EweҾvǀ|GWR?߻C^Vw% j*cvU> 'Ċ͔ -5\UY$}yܞVMLGgVdU RN$SJ0/W#e1XODo+bOfoۢ[LX7ZW TIlKP!3!y덏%!E/֡_ !E/֡.Is?eR4 SRmU Nۣ?sw`20EaḌg"g#dܵjGTQՃ^#4#Sˋ8bRgȫ 9ˏ5TOlV*Vd&eU.nps:cgT.EʈchM#AՈDu); cZbӻ=)tED燥B6jlL|"UI-<"G4͠օ LSj#:bʥ_!-]]XAheOݲ&9/e-gD6&B~"ΩLľR5j1,gvS[dX>)yyb^]>pO j72_o;!vY򅥳jE9θ4Q}^]{W&;/.XHKcTMCxTiƊn#u'ʊ(:9cdf97c5f5cb1af38b63ea3ebd82749ee351638fc6f1777388b7cd06c8a784ca99357245a163bdd84df8c3757a4c91d7e2e2d3f0j{y[cj{xpython-36.opt-1.pyc5%2Pc'ipymysql-1.1.2.dist-info-l2Ob'pymysqlinW7pymem.heVzpymath.h6Uepymactoolbox.h8Tt pymacconfig.hH2228X''p'l pylock.pyT<pylint3qT;pylint-config3onnT:v pylint-configT9dpylintac6ppyliblzma-0.5.3-py2.7.egg-infoect cpyliblzma-0.5.3T8a pyhtmlizer327?Qepygtkcompat.pyo3e>P8pygtkcompat.pyc5a=O5pygtkcompat.pyd02Hc pygtkcompatb3Z pygram.pyoortZ pygram.pyccvtZ pygram.pyepygpgme-0.3-py2.7.egg-infodcd 9 pygpgme-0.38cG6,pygobject-3.22.0-py2.7-linux-x86_64.egg-info7b?0pygments-lexerp'pygments-2.19.2.dist-info@2$2Lw''pygmentsrT7e pygmentize3caT69 pygmentized8cS. pygetopt.ha0dx5XL850: - 0.17-1.cp130Todd Rinaldo - 0.16-1.cp108Busy Camels - 0.15-1.cp108Busy Camels - 0.15-1.cp1198Todd Rinaldo - 0.15-1.cp1194Todd Rinaldo - 0.14-1.cp1194Nicolas Rochelemagne - 0.08-1.cp1170- Update from upstream: DateTime-Format-ISO8601 0.17- Update from upstream: DateTime-Format-ISO8601 0.16- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: DateTime-Format-ISO8601 0.15- Update from upstream: DateTime-Format-ISO8601 0.14- Update from upstream: DateTime-Format-ISO8601 0.080.170.170.17-1.cp130~el80.170.170.17ISO8601.pmTypes.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/DateTime/Format//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/DateTime/Format/ISO8601/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8515dfead2fbd153aef65163e8dfdb5f192ac1a1fe827c9fdafa3a65bd7cee49a?-hxBKߢ29d8cce0e502a1db73be1c4cd6131c6d618f28ece9d48c3437534a9209758118b3a35c1907ad583d8cdc22863687a0d421b02d24j{j{Ub1af79b280bab0470a1ea95627x(}P%X-Lx?9$X999b5kdc - pick up $KADMIND_ARGS from /etc/sysconfig/kadmin, if it exists, and pass it on to kadmind - pick up $KRB524D_ARGS from /etc/sysconfig/krb524, if it exists, and pass it on to krb524d *instead of* "-m" - set "forwardable" in [libdefaults] in the default krb5.conf to match the default setting which we supply for pam_krb5 - set a default of 24h for "ticket_lifetime" in [libdefaults], reflecting the compiled-in default- rebuild- rebuild- update to 1.3.6, which includes the previous fix- apply fix from Tom Yu for MITKRB5-SA-2004-004 (CAN-2004-1189)- fix deadlock during file transfer via rsync/krsh - thanks goes to James Antill for hint- rebuild- fix predictable-tempfile-name bug in krb5-send-pr (CAN-2004-0971, #140036)- silence compiler warning in kprop by using an in-memory ccache with a fixed name instead of an on-disk ccache with a name generated by tmpnam()- fix globbing patch port mode (#139075)- fix segfault in telnet due to incorrect checking of gethostbyname_r result codes (#129059)- remove rc4-hmac:norealm and rc4-hmac:onlyrealm from the default list of supported keytypes in kdc.conf -- they produce exactly the same keys as rc4-hmac:normal because rc4 string-to-key ignores salts - nuke kdcrotate -- there are better ways to balance the load on KDCs, and the SELinux policy for it would have been scary-looking - update to 1.3.5, mainly to include MITKRB5SA 2004-002 and 2004-003- rebuild- rebuild- incorporate revised fixes from Tom Yu for CAN-2004-0642, CAN-2004-0644, CAN-2004-0772- rebuild- incorporate fixes from Tom Yu for CAN-2004-0642, CAN-2004-0772 (MITKRB5-SA-2004-002, #130732) - incorporate fixes from Tom Yu for CAN-2004-0644 (MITKRB5-SA-2004-003, #130732)- fix indexing error in server sorting patch (#127336)- rebuilt- update to 1.3.4 final- update to 1.3.4 beta1 - remove MITKRB5-SA-2004-001, included in 1.3.4- rebuild- rebuild- apply updated patch from MITKRB5-SA-2004-001 (revision 2004-06-02)- rebuild- apply patch from MITKRB5-SA-2004-001 (#125001)- removed rpath- re-enable large file support, fell out in 1.3-1 - patch rcp to use long long and %lld format specifiers when reporting file sizes on large files- update to 1.3.3- update to 1.3.2- rebuild- rebuilt- rebuilt- catch krb4 send_to_kdc cases in kdc preference patch- remove patch to set TERM in klogind which, combined with the upstream fix in 1.3.1, actually produces the bug now (#114762)- when iterating over lists of interfaces which are "up" from getifaddrs(), skip over those which have no address (#113347)- prefer the kdc which last replied to a request when sending requests to kdcs- fix combination of --with-netlib and --enable-dns (#82176)- remove libdefault ticket_lifetime option from the default krb5.conf, it is ignored by libkrb5- fix bug in patch to make rlogind start login with a clean environment a la netkit rlogin, spotted and fixed by Scott McClung- include profile.d scriptlets in krb5-devel so that krb5-config will be in the path if krb5-workstation isn't installed, reported by Kir Kolyshkin- add more etypes (arcfour) to the default enctype list in kdc.conf - don't apply previous patch, refused upstream- fix 32/64-bit bug storing and retrieving the issue_date in v4 credentials- Don't check for write access on /etc/krb5.conf if SELinux- fixup some int/pointer varargs wackiness- rebuild- update to 1.3.1- pull fix for non-compliant encoding of salt field in etype-info2 preauth data from 1.3.1 beta 1, until 1.3.1 is released.- update to 1.3- correctly use stdargs- test update to 1.3 beta 4 - ditch statglue build option - krb5-devel requires e2fsprogs-devel, which now provides libss and libcom_err- rebuilt- gcc 3.3 doesn't implement varargs.h, include stdarg.h instead- update to 1.2.8- fix double-free of enc_part2 in krb524d- update to latest patch kit for MITKRB5-SA-2003-004- add patch included in MITKRB5-SA-2003-003 (CAN-2003-0028)- add patches from patchkit from MITKRB5-SA-2003-004 (CAN-2003-0138 and CAN-2003-0139)- rebux8X|L($<bel all mount runtime files in the restorecond example * genhomedircon: dynamically create genhomedircon * Allow returning of bastard matches * sepolgen: return and output constraint violation information * audit2allow: one role/type pair per line- Change polgen to generate dbus apps as optional so they can compile on minimal policy system, patch from Miroslav Grepl- Fix sepolgen/audit2allow to handle multiple role/types in avc messages properly- Fix restorecon to generate a better percentage of completion on restorecon -R /. - Have audit2allow look at the constaint violation and tell the user whether it - is because of user,role or level- userapps is generating sandbox code in polgengui- Remove load_policy symbolic link on usrmove systems this breaks the system- Update to upstream - policycoreutils * restorecond: wrong options should exit with non-zero error code * restorecond: Add -h option to get usage command * resorecond: user: fix fd leak * mcstrans: add -f to run in foreground * semanage: fix man page range and level defaults * semanage: bash completion for modules should include -a,-m, -d * semanage: manpage update for -e * semanage: dontaudit off should work * semanage: locallist option does not take an argument * sepolgen: Make use of setools optional within sepolgen - sepolgen * Make use of setools optional within sepolgen * We need to support files that have a + in them- Make restorecon exit with an error on a bad path- Fix setsebool command, handling of = broken. - Add missing error option in booleansPage- Fix sepolgen to use realpath on executables handed to it. - Brian Bickford- Allow stream sock_files to be stored in /tmp and etc_rw_t directories by sepolgen - Trigger on selinux-policy needs to change to selinux-policy-devel - Update translations - Fix semanage dontaudit off/on exception- Add -N qualifier to semanage, setsebool and semodule to allow you to update - policy without reloading it into the kernel.- add some definition to the standard types available for sandboxes- Remove lockdown wizard- Fix semanage fcontext -E to extract the equivalance customizations.- Add mgrepl patch to have sepolgen search for -systemd rpm packages- Apply Stef Walter patch for semanage man page- Rebuild to get latest libsepol which fixes the file_name transition problems - Update translations - Fix calls to close fd for restorecond- Update translations - Fix sepolgen to discover unit files in /lib/systemd/- Update translations - Fix segfault on restorecon- Allow filename transitions to use + in a file name- Change policycoreutils-python to require selinux-policy-devel package- Update to upstream - policycoreutils * sandbox: do not propogate inside mounts outside * sandbox: Removing sandbox init script, should no longer be necessary * restorecond: Stop using deprecated interfaces for g_io * semanage: proper auditting of user changes for LSPP * semanage: audit message to show what record(s) and item(s) have chaged * scripts: Update Makefiles to handle /usrmove * mcstrans: Version should have been bumped on last check in * seunshare: Only drop caps not the Bounding Set from seunshare * Add bash-completion scripts for setsebool and semanage * newrole: Use correct capng calls in newrole * Fix infinite loop with inotify on 2.6.31 kernels * fix ftbfs with hardening flags * Only run setfiles if we found read-write filesystems to run it on * update .po files * remove empty po files * do not fail to install if unable to make load_policy lnk file - sepolgen * Fix dead links to www.nsa.gov/selinux * audit.py Dont crash if empty data is passed to sepolgen * do not use md5 when calculating hash signatures * fix detection of policy loads- Have sepolgen script specify the pp file with the make cxX}LxA$QAB@escription for log_errors in php.ini- EA-11137: Update ea-php80 from v8.0.26 to v8.0.27 - PDO::quote() may return unquoted string). (CVE-2022-31631)- EA-11074: Update ea-php80 from v8.0.25 to v8.0.26- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11020: Update ea-php80 from v8.0.24 to v8.0.25 - GD: OOB read due to insufficient input validation in imageloadfont(). (CVE-2022-31630) - Hash: buffer overflow in hash_update() on long parameter. (CVE-2022-37454)- EA-10961: Update ea-php80 from v8.0.23 to v8.0.24- ZC-10009: Add changes so that it builds on AlmaLinux 9- ZC-10260: Link deb against libcurl 4 explicitly- EA-10915: Update ea-php80 from v8.0.22 to v8.0.23- EA-10864: Update ea-php80 from v8.0.21 to v8.0.22- EA-10820: Update ea-php80 from v8.0.20 to v8.0.21- EA-10760: Update ea-php80 from v8.0.19 to v8.0.20- EA-10703: Update ea-php80 from v8.0.18 to v8.0.19- EA-10636: Update ea-php80 from v8.0.17 to v8.0.18- EA-10575: Update ea-php80 from v8.0.16 to v8.0.17- EA-10532: Update litespeed to 8.0.1- EA-10505: Update ea-php80 from v8.0.15 to v8.0.16- EA-10447: Update ea-php80 from v8.0.14 to v8.0.15- ZC-9599: Fix Ubuntu 21 global regs problem- ZC-9589: Update DISABLE_BUILD to match OBS- ZC-9611: Dependency issue with php-enchant on Ubuntu- ZC-7456: Add support for php-sodium- EA-10365: Update ea-php80 from v8.0.13 to v8.0.14- EA-10284: Update ea-php80 from v8.0.12 to v8.0.13- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10225: Update ea-php80 from v8.0.11 to v8.0.12- EA-10044: Patch PHP-FPM/OpCache for kill_all_lockers bug (74709)- ZC-9370: Correct ea-php80 build issues- EA-10137: Disable upstream regression tests in favor of our own.- EA-10130: Update ea-php80 from v8.0.10 to v8.0.11- EA-10080: Update ea-php80 from v8.0.9 to v8.0.10- EA-10010: Update ea-php80 from v8.0.8 to v8.0.9- ZC-9089, ZC-9070: correction in opcache.ini- EA-9930: Update ea-php80 from v8.0.7 to v8.0.8- EA-9013: Optimize %check section- EA-9832: Update ea-php80 from v8.0.6 to v8.0.7- EA-9762: Update ea-php80 from v8.0.5 to v8.0.6- EA-9732: Update ea-php80 from v8.0.3 to v8.0.5- EA-9625: Update litespeed to 7.9- EA-9623: Update ea-php80 from v8.0.2 to v8.0.3- EA-9574: Update ea-php80 from v8.0.1 to v8.0.2- EA-9519: Update ea-php80 from v8.0.0 to v8.0.1- ZC-7880: Move PHP 8.0 to production- EA-9443: Update ea-php80 from v8.0.0rc4 to v8.0.0- ZC-8005: Replace ea-openssl11 with system openssl on C8- ZC-7865: Update to litespeed SAPI to 7.8- ZC-7985: remove libcurl updates for release- ZC-7969: Update description of non-DSO ea-php80-php to be more helpful- ZC-7961: Update to RC4- ZC-7862: Updates now that ea-libcurl builds on C8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- ZC-7254: Get DSO to buid- ZC-7310: Update to RC3- ZC-7497: Reinstate `runselftest`- ZC-7523: Update to beta 4- ZC-7369: Remove DSO from rpm- ZC-6260: Initial alpha build of php8hou-1 17889096678.0.30-11.19.3.cpanel8.0.30-11.19.3.cpanel8.0.30-11.19.3.cpanel20-intl.iniintl.so.build-id78f5c534bfa2843c36f7b28103c2a2372ff99511/opt/cpanel/ea-php80/root/etc/php.d//opt/cpanel/ea-php80/root/usr/lib64/php/modules//usr/lib//usr/lib/.build-id//usr/lib/.build-id/78/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectionobs://private/EA4-production/CentOS_8/aa64a8320f7305812f225655c44a8997-ea-php80cpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=78f5c534bfa2843c36f7b28103c2a2372ff99511, not strippeddirectoryъUʱ7utf-8412b81a7483e1f8e7137x(X~L@N$4roject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- open_init_pty: Do not error on EINTR - Fix [-s STORE] typos in semanage - Update sandbox types in sandbox manual - Update translations- Convert sandbox to gtk-3 using pygi-convert.sh (#1343166)- Fix typos in semanage manpages - Fix the documentation of -l,--list for semodule - Minor fix in a French translation - Fix the extract example in semodule.8 - Update sandbox.8 man page - Remove typos from chcat --help - sepolgen: Remove additional files when cleaning- Fix multiple spelling errors - Rebuild with libsepol-2.5-6- Rebuilt with libsepol-2.5-5- hll/pp: Warn if module name different than output filename- Ship selinux-autorelabel utility and systemd unit files (#1328825)- sepolgen: Add support for TYPEBOUNDS statement in INTERFACE policy files (#1319338)- Add documentation for MCS separated domains - Move svirt man page out of libvirt into its own- policycoreutils: use python3 in chcat(#1318408)- policycoreutils/sepolicy: selinux_server.py to use GLib instead of gobject - policycoreutils-gui requires python-slip-dbus (#1314685)- Update to upstream release 2016-02-23- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Fix 'semanage permissive -l' subcommand (#1286325) - Several 'sepolicy gui' fixes (#1281309,#1281309,#1282382)- Require at least one argument for 'semanage permissive -d' (#1255676)- Improve sepolicy command line interface - Fix sandbox to propagate specified MCS/MLS Security Level. (#1279006) - Fix 'audit2allow -R' (#1280418)- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- policycoreutils-gui needs policycoreutils-python (#1279046)- Rebuilt for Python3.5 rebuild- Revert the attempt to port -gui to GTK 3 (#1269328, #1266059)- newrole: Set keepcaps around setresuid calls - newrole: Open stdin as read/write- Fix several semanage issue (#1247714) - Decode output from subprocess, if error occurred (#1247039)- audit2allow, audit2why - ignore setlocale errors (#1208529)- Port sandbox to GTK 3 and fix issue with Xephyr- Fix another python3 issues mainly in sepolicy (#1247039,#1247575,#1251713)- Fix multiple python3 issues in sepolgen (#1249388,#1247575,#1247564)- policycoreutils-python3 depends on python-IPy-python3- policycoreutils-devel depends on policycoreutils-python-utils (#1246818)- Move python utilities from -python to -python-utilities - All scripts originally from policycoreutils-python use python 3 now- policycoreutils: semanage: fix moduleRecords deleteall method- Improve compatibility with python 3 - Add sepolgen module to python3 package- Add Python3 support for sepolgen module (#1125208,#1125209)- Update to 2.4 release- Fix typo in semanage args for minimum policy store- policycoreutils: semanage: update to new source policy infrastructure - semanage: move permissive module creation to /tmp- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- setfiles/restorecon: fix -r/-R option (#1211721)- Update to upstream 2.4- Temporary removed Requires:audit-libs-python from policycoreutils-python3 subpackage (#1195139) - Simplication of sepolicy-manpage web functionality (#1193552)- We need to cover file_context.XXX.homedir to have fixfiles with exclude_dirs working correctly - Use dnf instead of yum (#1156547)- Audit2allow will check for mislabeled files, and tells user to fix the label. - Also checks for basefiles and suggests creating a different label. - Patch from Ryan Hallisey- Switch back to yum. Need additional fixes to make it working correctly.- Switch over to dnf from yum- Improvements to audit2allow from rhallise@redhat.com * Check for mislabeled files. * Check for base file use and * Suggest writable files as alternatives- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Remove build requires for openbox, not needed- fix license handling- Examples are no longer in the main semanage man page (#1084390) - Add support for Fedora22 man pages. We need to fix it to not using hardcoding.xXL$K@K[KrK,K@KK@K@KK{@KzKs@Kl@Kie@KbKa|@Ka|@K`*KXAKUKO@KG@KG@KD{@K+nK*@K(K K?KK@K KK>J@JJ@J@Jݦ@JTJ`@JJս@J1@JęJęJH@J@Jv@J$J$J0@J0@J0@JG@JG@JJ^@JJu@J#J#JJ@J:J@J@JJJ@J@J Jyt@Jp9JlE@JS8JD@J'@J#JJJIIIIzI@IܑIIyI@IaI@II@IU@IIIIx_Iw@IuImIl@IcGIFFI?@I:i@I7@I5#@I3I1.IsI"@I-I9@I IP@IP@II@Ig@HrH~@Hf@Hf@HYH@He@HHH|@H@HoH)HH@H@HH@H@H@Ht@HsVHsVHkmHkmHj@HhH`H_@HVUHQHQHO@H-w@H-w@H(1@H(1@H!H!H@H@G@G@G߮G@GGGD@GOG[@G@G}G}G,@G,@G,@GGG@G@GZ@GGeGxGxGkGjY@GiGiGbp@G^{G]*@GR@GAzGAzGAzGAzG=@G=@G<4G2@G/G/G+@G)G(n@G@G@GJGGV@GV@GV@G@G@G'@G2G2G2FF@FIFFFFFwF&@F@F1FFޚ@FFF@F@FҼFF@FvFvFɂ@FuF@F@F;@FF@FFi@F@F@F{Fzh@Fo@Fo@Fm9@Fm9@FcFcF` @FNFLCF; @F7+F5@F/BF/BF-@F-@F(@F&@F&@F&@F&@F$F#e@F @FpF@FF*F*FAF F @F@F@E{@E@E@E@E@EE@E݅E݅EEEEK@EVEɿ@E@EJ@EJ@EJ@EE@E@Ex@EEEE=E@EEI@E%E@EEySEx@EvEp@Emv@Emv@Emv@El$El$EfEd;EaEaE]@E\RE\RE[@E[@E[@E[@EYEYES@EO#E*9E&E@E E~E~E~E@E D@E D@EEEOE[@E D@D@D D D@D@D@D@DDD@DГDГDB@DȪDD@D{D{DA@DX@D@D4D@DD@DDW@DDDD|3DvDtJDtJDr@DoDhm@Dhm@Dhm@DaD_2D]@DYDGwDC@D?D5D5D3@D*vD)%@DDDDD@DDDDj@Dj@D $@D/C@CC@CtC@CCCCEC@CC @Ch@Ch@Ch@Ch@C@C@C@C-C-C-C@CCCǖ@CáCáC @C @CCC,C8@CC@C@C@CC @CqCqC @CCC}@C+C@CC@CBC@C|pC{@Cx|@CtCqCqCp@Cp@CoAC^@C^@CWCTCTCP@COCNL@CLCJWCFc@CECC@C:C:C1K@C/C)b@C&@C%mCC@C@C@C C C @C&BTBBw@BۙB@B@BB]@B@B@BBB@BBr!B^[@B] BZfBZfBU BS@B9q@B6@B06B.@B-B$Y@B#B@B@BBp@BB@B*@B@B@B@B @B LB LB @BBX@BBAA)@A)@AA@AAAA@An@A3A3A3AҜ@AƾAA@AAx@Ax@Ak@A]FA]FAT @ARAPA@EA3A,@A,@A,@A+-A+-A)@A(A AA,AA@@ @@@@@7@@7@@@@@@@@@p@@@@@@@@@@5@@5@@@@@c@@n@n@z@@@@@b@@z@u>@mU@l@@h@h@h@h@d@@b@`&@Y@@Y@@Y@@X=@X=@X=@X=@X=@U@U@U@O@@M@M@Hk@=@=@=@;<@4@@,@@@@@@@R??@??D@?@?@?z?q@?a@?a@?2?@?2?@?2?@?/@><@Vit Mojzis - 2.9-26Vit Mojzis - 2.9-25Vit Mojzis - 2.9-24Vit Mojzis - 2.9-23Vit Mojzis - 2.9-22Vit Mojzis - 2.9-21.1Vit Mojzis - 2.9-20Vit Mojzis - 2.9-19Vit Mojzis - 2.9-18Petr Lautrbach - 2.9-17Vit Mojzis - 2.9-16Vit Mojzis - 2.9-15Vit Mojzis - 2.9-14Vit Mojzis - 2.9-13Petr Lautrbach - 2.9-12Vit Mojzis - 2.9-11Vit Mojzis - 2.9-10Vit Mojzis - 2.9-9Vit Mojzis - 2.9-8Petr Lautrbach - 2.9-7Petr Lautrbach - 2.9-6Vit Mojzis - 2.9-5Petr Lautrbach - 2.9-4Vit Mojzis - 2.9-3Petr Lautrbach - 2.9-2Petr Lautrbach - 2.9-1Petr Lautrbach - 2.8-16.1Petr Lautrbach - 2.8-15Petr Lautrbach - 2.8-14Petr Lautrbach - 2.8-13Petr Lautrbach - 2.8-12Petr Lautrbach - automatic rebuild- FHS packaging.- compress man pages.- auto rebuild in the new build environment (release 10)- translations modified for de, fr, tr- fixed the spec file; added BuildRoot-built against glibc  !"5.10.1-12.el85.10.1-12.el8 cicoidentmergercsrcscleanrcsdiffrcsfreezercsmergerlog.build-id3a7472f8b13f1e5d84676392fd568b82593db4d768f1455731ab3f8e8a60585281779590b86aa66adebe235e4a02b0958c1868cf4c91b51d61ba9132rcsCOPYINGChangeLogNEWSREADMETHANKSrcs.info.gzci.1.gzco.1.gzident.1.gzmerge.1.gzrcs.1.gzrcsclean.1.gzrcsdiff.1.gzrcsmerge.1.gzrlog.1.gzrcsfile.5.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/3a//usr/lib/.build-id/68//usr/lib/.build-id/de//usr/share/doc//usr/share/doc/rcs//usr/share/info//usr/share/man/man1//usr/share/man/man5/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu POSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3a7472f8b13f1e5d84676392fd568b82593db4d7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=68f1455731ab3f8e8a60585281779590b86aa66a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=debe235e4a02b0958c1868cf4c91b51d61ba9132, strippeddirectoryASCII textUTF-8 Unicode texttroff or preprocessor input, ASCII txXL0$R00HFp?AHd  R  EKT  4       8    ( 8 e9xe: /eG54H5I6X60Y68\6P]6^8J b9Hd:e:f:l:t:u;,v; w?Px?y@0'@@@AADAXA\6C C6 EFFDFHFdgFhhFlCtcp_wrappers7.696.el8A security tool which acts as a wrapper for TCP daemonsThe tcp_wrappers package provides small daemon programs which can monitor and filter incoming requests for systat, finger, FTP, telnet, rlogin, rsh, exec, tftp, talk and other network services. Install the tcp_wrappers program if you need a security tool for filtering incoming network services requests. This version also supports IPv6._:buildhw-x86-09.iad2.fedoraproject.orgQFedora ProjectFedora ProjectBSDFedora ProjectUnspecifiedftp://ftp.porcupine.org/pub/security/index.htmllinuxx86_64 2Pd JW Jz~ AAAAAA큤A큤_9_9_9_9_9_9_9_9_9_9_9_9_9_9323.3232 /W1U8 3>iD_91_71+<_7_7fc312baa87e54d66377b1cc3f6449078dc7b37412cb5aabf3427eb93c069a6c23f1bebb929d1a4cfa4d724151e2e37fc04bb06d2c96c0d483c96ae0e35c8a2bb7f0c874d00a532e3790124d0ae9699f4d4a079d7fc91a05134b8e4a507fd8ed578259d88f07009e4b95e5fb34d4f8199f986b6696a09c097ba270c67f6b71ef6ba6ca8ba9ee13ef06fd505b3d9e5b285d454a0e72b86349ac550c1bf7bb075ccfb72e2ed8672343cb559c943298ed0ccf6d0e01e3de001326a45d2b05e7d2a4c534018d32b10870dbd1dbfbddb6e0b70337aac62a2589306eacf7611916e442bdd6d7333a48de967de52f892531dc8a320ef3e29f81fcfbea41808d46c819098e098858c27241cce171de145f067a1adf82d894a9d486450958c3941db60241ddd4b0185b3ffd62f9f5362f3be33bffc0e1413bc6d6f837a3cea441da64c74fa82628d3b900e8502f3311bbf36ae33c43994709d3c945d10980d5690d407674f8448a31bf8cc640a6abc9b5991150441695b916a87707e9a6e88d829daf7223c2f358f3b311ce6c3a45da82f7ffddeff522d80ed8f10e511dfcfeb60da3452c38f2c30cda4487d88eedefe9bbc4bac1baa29a342f2037dea51c7e811e8a1c5ba80b721b5c7cfd68c9e9630dc9fd33eaba7d394f2a08e89a49a648a343d32888d10595cf6bdb194fb4ebc1a52542c4d5d16a69e02fe3addf0adfaacf19c179b26b26c728a55acea484d95d131a6ba558ec6334853f4e164cb0fbc0894eee9a747../../../../usr/sbin/try-from../../../../usr/sbin/safe_finger../../../../usr/sbin/tcpd../../../../usr/sbin/tcpdmatchrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroottcp_wrappers-7.6-96.el8.src.rpmtcp_wrapperstcp_wrappers(x86-64)@@@@@@@@@@    @libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.xX LBx$.brown@cpanel.net> - 7.4.33-4Tim Mullin - 7.4.33-3Travis Holloway - 7.4.33-2Cory McIntire - 7.4.33-1Cory McIntire - 7.4.32-1Cory McIntire - 7.4.30-1Cory McIntire - 7.4.29-1Travis Holloway - 7.4.28-2Cory McIntire - 7.4.28-1Tim Mullin - 7.4.27-5Julian Brown - 7.4.27-4Julian Brown - 7.4.27-3Julian Brown - 7.4.27-2Cory McIntire - 7.4.27-1Cory McIntire - 7.4.26-1Dan Muey - 7.4.25-2Cory McIntire - 7.4.25-1Julian Brown - 7.4.24-23Cory McIntire - 7.4.24-2Cory McIntire - 7.4.24-1Travis Holloway - 7.4.23-1Cory McIntire - 7.4.22-1Cory McIntire - 7.4.21-1Travis Holloway - 7.4.20-2Cory McIntire - 7.4.20-1Cory McIntire - 7.4.19-1Cory McIntire - 7.4.18-1Cory McIntire - 7.4.16-2Cory McIntire - 7.4.16-1Cory McIntire - 7.4.15-1Cory McIntire - 7.4.14-1Julian Brown - 7.4.13-2Cory McIntire - 7.4.13-1Tim Mullin - 7.4.12-2Cory McIntire - 7.4.12-1Daniel Muey - 7.4.11-4Tim Mullin - 7.4.11-3Daniel Muey - 7.4.11-2Cory McIntire - 7.4.11-1Tim Mullin - 7.4.10-2Cory McIntire - 7.4.10-1Cory McIntire - 7.4.9-1Tim Mullin - 7.4.8-2Cory McIntire - 7.4.8-1Julian Brown - 7.4.7-2Cory McIntire - 7.4.7-1Tim Mullin - 7.4.6-3Tim Mullin - 7.4.6-2Cory McIntire - 7.4.6-1Daniel Muey - 7.4.5-3Tim Mullin - 7.4.5-2Cory McIntire - 7.4.5-1Julian Brown - 7.4.2-3Daniel Muey - 7.4.2-2Daniel Muey - 7.4.2-1Dan Muey - 7.4.1-1- EA4-173: Mark ea-php74 as EOL- EA4-230: Use system libxml2 in PHP 7.4- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12614: Rolling “ea-php74” back to “2ae8a0c01d69dbc710734ff516c17a19a479fa13”: was not meant to be merged- ZC-12614: Build on Alma 9- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- ZC-12246: Correct conffiles for Ubuntu- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: work around `%doc` and `PHP` behavior changes from C7 to c9- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link with libc-client statically- ZC-10873: Do not build on Ubuntu 22- EA-11075: Correct default value description for log_errors in php.ini- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11038: Update ea-php74 from v7.4.32 to v7.4.33- EA-10957: Update ea-php74 from v7.4.30 to v7.4.32- EA-10757: Update ea-php74 from v7.4.29 to v7.4.30- EA-10632: Update ea-php74 from v7.4.28 to v7.4.29- EA-10532: Update litespeed to 8.0.1- EA-10504: Update ea-php74 from v7.4.27 to v7.4.28- EA-10461: Patch PHP-FPM/OpCache for kill_all_lockers bug (74709)- ZC-9611: Dependency issue with php-enchant.- ZC-9598: Fix Ubuntu 21 global regs problem- ZC-7454: Add php-sodium- EA-10364: Update ea-php74 from v7.4.26 to v7.4.27- EA-10279: Update ea-php74 from v7.4.25 to v7.4.26- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10228: Update ea-php74 fromxpXXL[K$K[KG?2P?1|d * Fx| 11 1 X1 1 1 11y1n1d"H"h#"(#R8#\9#d:#G$1H$1I%1X%Y(,\+ 1]+1^-b.d/fe/kf/nl/pt/1u0L1v11,10161x11 112 212Dg2Hh2LCcpanel-perl-542-uri-db0.231.cp130~el8CPAN module - Database URIsCpanel build perl module 'URI::db'Database URIshbh-centos-8.dev.cpanel.netSperlcpanel/perlhttps://metacpan.orglinuxnoarch]cf|LHK$[E__a40KFHDfHiH/k;@BCHHFdIJ~/cwN$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh90a4239e07e11a7d406d62260c0182ba3a932a007beb30516ef729524d30404034e0e18162fcecd76ded18394f86c6ba2335857283092f11345a544c5cd035a20f8473d1d18c23aac73e5a1a4d002725f7b5bf487445d8f35f9348f20f5ad46cb7e10ceb1861034bb3f607383c0faf599fe5c9f1b37f153c98428f8964fd531de57cecca9c99f035f8d2725c235371a1780c4c7ffc6fd7f1601080277515683518a104f7eadba62dc3f766071414939d19874d3ffcc534ae1bf71b425be1d9eab1f4b110e91100a5f344dd9adea344731f232c37a697221b951e1ba53826f840859407995400927c7c29d83c7bd7ca4c4cbdbd1195929a116f882768c8488e9198736f4e99abb7c495010d18ede54c2e1c1d9fe4d595a180a3c48c971acc35ef1dce3eb03896b0d89b532aa5c7ce15f67d7f3e5f8d7c5163d08d1e5c68078a7c58ace52aa8d0b8da4a1d5c5496b4ded8f3d2b498911aba062d73472c6e4becad4f1409fa822b9a4dda778d8d0ed393e57107c5f87b85a6307c8b7678a7feb718b443b48505e35ef759f4a6af4bd0ea6e2d8eca6fb406886b40c1e8cabde76ec22d364bcbb50a78a733883d91928ff894071d9a0a88e78b64905168b8ba3c5cf03eb9ba2267293bf515d779b9a277aa28797d95b44a158a4175374ee015a36febcea9e15020ec2687fc2e2abe1f36ac4c1ea36da49dcf453279d75392cb489b58981edabeed4aa7ce60e697d8073723a589bb37b94d44540af10ee596680f6b61edba936771052908ff0694fc1c0da30f6a1cb19acdf480a7804e12a82944425da5da26f72b72e4927ed0ab138fb0f19e1711880b0e05f75a47b8caefb2ebd04487617bde0e3d03efb600f736fab4d0fa0e496a1bd578cc052489d74f496ce1a3d390e77abdc993d71fc4be5b76380a857a4f985f7f22e0e7caac0bd66e55474761ef093bff01cab2a13e06d8a8df84876832020c3e71d60109246136eb025a252f468c185cc4dea825bb3a6806c35dcd179eec011049f51ca86deba10144b67e4ac539b9f6bc43a514fe9293d7c0a7fb9655662dafdd7ae672134b3ced94fe0d93ede728882ea017d655ae15e3c081e86294084036b2fc7be58452c771ba6d5d719c8f02dd7436e5ce5c4d5765a769aa9e965f04406671d2da6a3c103174122ac7b0d499e7e7b6e4b0b6bd9ce4f976e711526b668984218a22a9fbe6303358f95fa868a68a3944eb40c377dfd55e9a4fc170b884fcb54daea79b9fc1bc0b2c3c737edbe12165eaa5e60929eebb6abe138a5f035436ee816e22cc3bfe392993da47bbc8a3984eaa027a676d4b2478ffc3a95a8d960aa177629c6497ea8c79654de663337247eb23971660480a5f60c2242af3c1d18fa90c41e59932caf96208c52745c23e7409ac52dd327551f02d3c136a5013d49da4d013fde6710fbd25b590ec7c8d62b2308554c11bfa8d793527dc5c74edd56022ea4d6b4ecb8ba50558c3f11eee7a69091260c263bd94e865b17618e18f2c0e021f27101ec5fd894158f4524cf750f87187e987de1ad42fc99b41755bfc966e78734dxXL85RC$SCBF0T?+|d * b &3 7Tou|    =  T:(8K9K:KF' G' H'4I'HX'PY'\\']'^'b(c)d*'e*,f*/l*1t*Lu*`v*tz++,+0+6+x++- - //0<0@0Hg0Lh0PCea-php80-php-intl8.0.3011.19.3.cpanelEOL Internationalization extension for PHP applicationsphp 8.0 has reached End of Life. The ea-php80-php-intl package contains a dynamic shared object that will add support for using the ICU library to PHP.jchou-1 EA4-production / CentOS_8cPanel, Inc.PHPSystem Environment/Librarieshttps://endoflife.date/phplinuxx86_641 BAAj$j@jbjbjb387055e5461becbf6796c56d4c329be45879ff93591a0d77c438bebe90e8069865fdd341d03b63fc3214caab0ff793ac36ccb4c6024da830864b7967af010f3d../../../../opt/cpanel/ea-php80/root/usr/lib64/php/modules/intl.sorootrootrootrootrootrootrootrootrootrootea-php80-php-8.0.30-11.19.3.cpanel.src.rpmconfig(ea-php80-php-intl)ea-php80-php-intlea-php80-php-intl(x86-64)@@@@@@@@@@@@@@@@    @config(ea-php80-php-intl)ea-libicuea-php80-php-cli(x86-64)ea-php80-php-common(x86-64)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libicui18n.so.77()(64bit)libicuio.so.77()(64bit)libicuuc.so.77()(64bit)libm.so.6()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(CXXABI_1.3.8)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)8.0.30-11.19.3.cpanel8.0.30-11.19.3.cpanel8.0.30-11.19.3.cpanel3.0.4-14.6.0-14.0-15.2-14.14.3iC@i`h@g}@g@fo@fKe4@ehy@ee@d@ddu@df@dddX@d,@cwc@ccEcs@c[@c6@c5c1@cbbb2@b|bY^@b3"b\@b@aNaՈ@a@adaa{aa@aqV@an@a]aV@aLl@a'@a@`#@`ݮ@`ٹ`` @``B@`@`3@____G@_@_i_#_@_@____"_i@_FN_ @Brian Mendoza - 8.0.30-11Gary Stanley - 8.0.30-10Chris Castillo - 8.0.30-9Dan Muey - 8.0.30-8Julian Brown - 8.0.30-7Dan Muey - 8.0.30-6Julian Brown - 8.0.30-5Travis Holloway - 8.0.30-4Tim Mullin - 8.0.30-3Julian Brown - 8.0.30-2Cory McIntire - 8.0.30-1Cory McIntire - 8.0.29-1Travis Holloway - 8.0.28-6Julian Brown - 8.0.28-5Julian Brown - 8.0.28-4Brian Mendoza - 8.0.28-3Julian Brown - 8.0.28-2Cory McIntire - 8.0.28-1Tim Mullin - 8.0.27-2Cory McIntire Q@Todd Rinaldo - 1.408-1.cp130Busy Camels - 1.406-1.cp108Busy Camels - 1.406-1.cp1198Todd Rinaldo - 1.406-1.cp1156Todd Rinaldo - 1.404-1.cp1146Todd Rinaldo - 1.402-1.cp1136- Update from upstream: Email-MessageID 1.408- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Email-MessageID 1.406- Update from upstream: Email-MessageID 1.404- Update from upstream: Email-MessageID 1.4021.4081.408-1.cp130~el81.408MessageID.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Email/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8944ef8c2fdb321c72fa23e570707d1b2674f202feca07199f5e881faa05cea6e?.=Ƽ/W6d14dbcb0282694506b3efe2a4eae4226e531dcbb3164109fd54d6e53be24d93a267a3ad0cd6ba6c90e8340cc9a127db9fcfc005j{nj{U-streamcpanel-perl-536-dbd-memcpanel-perl-536-dbd-mem-datasourcecpanel-perl-536-dbd-mem-dbcpanel-perl-536-dbd-mem-drcpanel-perl-536-dbd-mem-stcpanel-perl-536-dbd-mem-statementcpanel-perl-536-dbd-mem-tablecpanel-perl-536-dbd-nullpcpanel-perl-536-dbd-proxycpanel-perl-536-dbd-proxy-dbcpanel-perl-536-dbd-proxy-drcpanel-perl-536-dbd-proxy-stcpanel-perl-536-dbd-spongecpanel-perl-536-dbdicpanel-perl-536-dbicpanel-perl-536-dbi(x86-64)cpanel-perl-536-dbi-commoncpanel-perl-536-dbi-const-getinfo-ansicpanel-perl-536-dbi-const-getinfo-odbccpanel-perl-536-dbi-const-getinforeturncpanel-perl-536-dbi-const-getinfotypecpanel-perl-536-dbi-dbdcpanel-perl-536-dbi-dbd-metadatacpanel-perl-536-dbi-dbd-sqlenginecpanel-perl-536-dbi-dbd-sqlengine-datasourcecpanel-perl-536-dbi-dbd-sqlengine-dbcpanel-perl-536-dbi-dbd-sqlengine-drcpanel-perl-536-dbi-dbd-sqxoXLȃ~3$#324).- Update to 2.1.35.- Update to 2.1.34.- Update to 2.1.33, fixes #604924.- Update to 2.1.32, fixes #546116.- Update to 2.1.31, fixes #529584.- Update to 2.1.30, see NEWS for details. - Improve summary and description. - Add MIT to License: for mailcap.4 man page. - Specfile cleanup.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- update mime.types (Ville Skyttä) (#476455)- add new entries from perl-libwww-perl's media.types (Ville Skyttä) (#432290)- associate *.ent with text/xml-external-parsed-entity (Ville Skyttä) (#431722)- use xdg-open (Ville Skyttä) (#388481) - spec cleanup (#226116)- add image/vnd.microsoft.icon to mime.types (#247222)- add text/x-vcard to mime.types (#243889) - mark configs noreplace, cleanup spec a bit- add video/x-flv to mime.types (#205239)- add java/mobile mime types (#201512 )- add audio and video x-ms mime types (#197840)- rebuild- add OpenOffice.org 2.0 mime types (#173789)- rebuilt- s/ggv/evince/ (#150509)- add iso, img to octet-stream (#142459 )- pdfs -> back to ggv- eog -> gthumb - pdfs -> gpdf- xpdf/gv -> ggv (#118401) - add application/x-bittorrent (#118752)- add application/ogg and OpenOffice.org mime.types- resync mime.types with apache - clean out mailcap some- add application/x-ogg to mime.types- use eog instead of ee- resync mime.types with apache 1.3.26- fix Sep. 17 changes (#57362)- resync mime.types with apache 1.3.22- associate PS files with gv (#53734)- switch gtv & xanim order (#51408)- use htmlview for text/html (#48141)- Use gtv not xanim for video/mpeg, since we no longer ship the codecs.- use gpg, not pgp (#13816, others)- fix typo (#23409)- reintegrate stuff into the package so it doesn't get lost- add ms(TM) word document entry (Bug #17474) - bzip2 sources- add wap entries- remove mailcap.vga- handle compressed man pages- add .bz2- add tgz/gz to gzip- rpm files are RPM files. :)- fix typo in pdf entry (#2618).- comment out play- updated mime type for images from xv to ee - cleaned up for our new version of the package which is in CVS- updated mime.types- comment out backticked %variables to work around security problems- glibc version 2.1- we don't ship tracker, use mikmod instead- build root- translations modified for de, fr, tr- added /etc/mime.types from mutt to this package to make it universal- made a noarch package2.1.48-3.el82.1.48-3.el8mailcapmime.typesmailcapNEWSmailcapCOPYINGmailcap.4.gz/etc//usr/share/doc//usr/share/doc/mailcap//usr/share/licenses//usr/share/licenses/mailcap//usr/share/man/man4/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m32 -march=x86-64 -mtune=generic -mfpmath=sse -mstackrealign -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuASCII textUTF-8 Unicode textdirectorytroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)utf-8ffa67b00077d47d85640e89e2eaec0a46907381a47f5284f5ca954d678bc8810?pH` Qd~ XC:L٧5!!! H]w[3WD浉vew"UlĈP>kd~DSCG#-`}&s/`飹gSHmw"W0CiuqL=癓I98'JZho/@>n6:0QYlTUJlg?=e{-dRH L8|[)˰sC $Ҵ7#?*b'/ &㢁'ံt^ójLXzL򾿑baAt(nV^B=hhRTQ#<"0R`M &p[Jq}M":"!;4F !AP<_2YP()` Qd~껡 BG\S-@p&ma' ׮+~aU7yzd#4xP_XL`X9$'9991802334- New upstream release (1.18.2) - Resolves: #1802334- Omit KDC indicator check for S4U2Self requests - Resolves: #1802334- Pass gss_localname() through SPNEGO - Resolves: #1802334- New upstream version (1.18.1) - Resolves: #1802334- New upstream version (1.18) - Resolves: #1802334 - Resolves: #1820311 - Resolves: #1791062 - Resolves: #1784655- Put KDB authdata first - Resolves: #1800575- OpenSSL has an epoch, apparently - Resolves: #1754690- Put openssl runtime requirement in the right place this time - Resolves: #1754690- Restore accidentally dropped patch - Resolves: #1754690- Fix krb5kdf support and add proper openssl version requirements - Resolves: #1754690- Full FIPS compliance - Resolves: #1754690- Backport soft-pkcs11 testing code - Resolves: #1734158- Fix KCM client time offset propagation - Resolves: #1738553- Fix source URLs in spec file - Resolves: #1755959- Fix argument order on strlcpy() in enctype_name() - Resolves: #1754369- Clean up etype display on KDC - Resolves: #1664157- Fix pkinit_anchors path - Resolves: #1661339- Re-provide krb5-kdb-version in -devel as well (IPA wants it) - Resolves: #1645594- Move kdbversion info into -server for IPA (so we can rebase) - Resolves: #1645594- FIPS: disable 3DES and ed25519 - Resolves: #1616326- Use openssl's PRNG in FIPS mode - Resolves: #1663571- Address some optimized-out memset() calls - Resolves: #1663503- New upstream version (1.17) - Resolves: #1645594- Remove incorrect KDC assertion - Resolves: #1673016- Fix RC4 blocking in FIPS mode - Resolves: #1660222- Gain FIPS awareness - Resolves: #1660222- In FIPS mode, add plaintext fallback for RC4 usages and taint- Fix k5test prompts for Python 3- Remove outdated note in krb5kdc man page- Make krb5kdc -p affect TCP ports- Eliminate preprocessor-disabled dead code- Fix some broken tests for Python 3- Zap copy of secret in RC4 string-to-key- Convert Python tests to Python 3- Add build dependency on gcc- Use SHA-256 instead of MD5 for audit ticket IDs- Add BuildRequires on python2 so we can run tests at build-time- Explicitly look for python2 in configure.in- Add flag to disable encrypted timestamp on client- Switch to python3-sphinx for docs - Resolves: #1590928- Make docs build python3-compatible - Resolves: #1590928- Update includedir processing to match upstream- Log when non-root ksu authorization fails - Resolves: #1575771- Remove "-nodes" option from make-certs scripts- New upstream release - 1.16.1- Fix configuration of default ccache name to match file indentation- Set error message on KCM get_princ failure- Set error message on KCM get_princ failure- Fix KDC null dereference on large TGS replies- Explicitly use openssl rather than builtin crypto - Resolves: #1570910- Merge duplicate subsections in profile library- Restrict pre-authentication fallback cases- Be more careful asking for AS key in SPAKE client- Zap data when freeing krb5_spake_factor- Continue after KRB5_CC_END in KCM cache iteration- Fix SPAKE memory leak- Fix gitignore problem with previous patchset- Add SPAKE support - Improve protections on internal sensitive buffers - Improve internal hex encoding/decoding- Fix problem with ccache_name logic in previous build- Add pkinit_anchors default value to krb5.conf - Reindent krb5.conf to not be terrible- Log preauth names in trace output - Misc bugfixes from upstream- Add PKINIT KDC support for freshness token- Exit with status 0 from kadmind- Fix hex conversion of PKINIT certid strings- Fix capaths "." values on client - Resolves: 1551099- Fix flaws in LDAP DN checking - CVE-2018-5729, CVE-2018-5730- Fix a leak in the previous commit - Restore dist macro that was accidentally removed - Resolves: #1540939- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Process included directories in alphabetical order- Fix network service dependencies - Resolves: #1525230- New upstream release (1.16) - No changes from beta2- New upstream prerelease (1.16-betaxNXLaO$eOOO@@@@@@    @/bin/sh/bin/sh/bin/sh/bin/shconfig(unbound-libs)libc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.26)(64bit)libc.so.6(GLIBC_2.27)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libcrypto.so.1.1(OPENSSL_1_1_1)(64bit)libevent-2.1.so.6()(64bit)libexpat.so.1()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpython3.6m.so.1.0()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libunbound.so.2()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)shadow-utilssystemdsystemdsystemd1.16.2-5.14.el8_103.0.4-14.6.0-14.0-15.2-14.14.3js%jhj:u@j9i%@h @g3C@fU@e@e @eN@cJcJcEZbL@bc@bbb1@`@`lM@_N7^ϧ^˳@^@^H]][`O@[U@[O+[I[CN@[<[:[3|@[3|@[0@ZUZUZa@ZI@Z`@ZZ_@Z_@Z$Z}@Ze@Z6\@YY@Y{Y*@Y@Y3Y@YyYX@YK@Y?Y9<@YXg@XXXXj@Xj@XZnXWXW_@W@W~D@WbW^@WVVV@VjVEV9@V @U@U6@UUUUU~@Ud`@US$U/@UTfT@T@T@TxcTxcTuTl@T"@S@SSP@Sb7@S!RRe@R:@RC@R@QB@QQکQ@Q@Q@QQu&@Qq1Qm=@Qg@Qb@Q5@Q#@PqP@Pb@PE@P6@P@P @LLLk@Lk@LLK@K8@K@KK}+KC)J@J@J@JF@JlE@J<@J<@JJIIV@II2Il@IsImIa@Ia@I= @I3I/@I%Q@I#I#Ih@HH@H!@H@H@H}H4H4HH$Fedor Vorobev - 1.16.2-5.14RHEL Packaging Agent - 1.16.2-5.13Fedor Vorobev - 1.16.2-5.12Fedor Vorobev - 1.16.2-5.11Petr Menšík - 1.16.2-5.10Tomas Korbar - 1.16.2-5.9Petr Menšík - 1.16.2-5.8Petr Menšík - 1.16.2-5.7Petr Menšík - 1.16.2-5.6Petr Menšík - 1.16.2-5.3Tomas Korbar - 1.16.2-5.1Petr Menšík - 1.16.2-5Petr Menšík - 1.16.2-4Petr Menšík - 1.16.2-3Petr Menšík - 1.16.2-2Petr Menšík - 1.16.2-1Petr Menšík - 1.16.0-2Petr Menšík - 1.16.0-1Richard Lescak - 1.7.3-18Artem Egorenkov - 1.7.3-17Artem Egorenkov - 1.7.3-16Anna Khaitovich - 1.7.3-15Anna Khaitovich - 1.7.3-14Anna Khaitovich - 1.7.3-13Anna Khaitovich - 1.7.3-12Artem Egorenkov - 1.7.3-11Tomas Korbar - 1.7.3-10Tomas Korbar - 1.7.3-9Petr Menšík - 1.7.3-8Petr Menšík - 1.7.3-7Petr Menšík - 1.7.3-6Fedora Release Engineering - 1.7.3-5Petr Menšík - 1.7.3-4Petr Menšík - 1.7.3-3Miro Hrončok - 1.7.3-2Petr Menšík - 1.7.3-1Petr Menšík - 1.7.2-3Tomas Hozza - 1.7.0-6Petr Menšík - 1.7.0-5Paul Wouters - 1.7.0-4Paul Wouters - 1.7.0-3Paul Wouters - 1.7.0-2Paul Wouters - 1.7.0-1Petr Menšík - 1.6.8-6Petr Menšík - 1.6.8-5Petr Menšík - 1.6.8-4Filipe Rosset - 1.6.8-3Igor Gnatx=XLX 9$S999 depends on -workstation which also includes them- tighten up default permissions on kdc.conf and kadm5.acl (#558343)- use portreserve correctly -- portrelease takes the basename of the file whose entries should be released, so we need three files, not one- suppress warnings of impending password expiration if expiration is more than seven days away when the KDC reports it via the last-req field, just as we already do when it reports expiration via the key-expiration field (#556495) - link with libtinfo rather than libncurses, when we can, in future RHEL- krb5_get_init_creds_password: check opte->flags instead of options->flags when checking whether or not we get to use the prompter callback (#555875)- use portreserve to make sure the KDC can always bind to the kerberos-iv port, kpropd can always bind to the krb5_prop port, and that kadmind can always bind to the kerberos-adm port (#555279) - correct inadvertent use of macros in the changelog (rpmlint)- add upstream patch for integer underflow during AES and RC4 decryption (CVE-2009-4212), via Tom Yu (#545015)- put the conditional back for the -devel subpackage - back down to the earlier version of the patch for #551764; the backported alternate version was incomplete- use %global instead of %define - pull up proposed patch for creating previously-not-there lock files for kdb databases when 'kdb5_util' is called to 'load' (#551764)- fix conditional for future RHEL- add upstream patch for KDC crash during referral processing (CVE-2009-3295), via Tom Yu (#545002)- refresh patch for #542868 from trunk- move man pages that live in the -libs subpackage into the regular %{_mandir} tree where they'll still be found if that package is the only one installed (#529319)- and put it back in- back that last change out- try to make gss_krb5_copy_ccache() work correctly for spnego (#542868)- make krb5-config suppress CFLAGS output when called with --libs (#544391)- ksu: move account management checks to before we drop privileges, like su does (#540769) - selinux: set the user part of file creation contexts to match the current context instead of what we looked up - configure with --enable-dns-for-realm instead of --enable-dns, which isn't recognized any more- move /etc/pam.d/ksu from krb5-workstation-servers to krb5-workstation, where it's actually needed (#538703)- add some conditional logic to simplify building on older Fedora releases- don't forget the README- specify the location of the subsystem lock when using the status() function in the kadmind and kpropd init scripts, so that we get the right error when we're dead but have a lock file - requires initscripts 8.99 (#521772)- if the init script fails to start krb5kdc/kadmind/kpropd because it's already running (according to status()), return 0 (part of #521772)- work around a compile problem with new openssl- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rebuild to pick up the current forms of various patches- simplify the man pages patch by only preprocessing the files we care about and moving shared configure.in logic into a shared function - catch the case of ftpd printing file sizes using %i, when they might be bigger than an int now- try to merge and clean up all the large file support for ftp and rcp - ftpd no longer prints a negative length when sending a large file from a 32-bit host- pam_rhosts_auth.so's been gone, use pam_rhosts.so instead- switch buildrequires: and requires: on e2fsprogs-devel into buildrequires: and requires: on libss-devel, libcom_err-devel, per sandeen on fedora-devel-list- fix a type mismatch in krb5_copy_error_message() - ftp: fix some odd use of strlen() - selinux labeling: use selabel_open() family of functions rather than matchpathcon(), bail on it if attempting to get the mutex lock fails- compile with %{?_smp_mflags} (Steve Grubb) - drop the bit where we munge part of the error table header, as it's not needed any more- add and own %x-XLخ$b 16: Update ea-php81 from v8.1.9 to v8.1.10- EA-10865: Update ea-php81 from v8.1.8 to v8.1.9- EA-10821: Update ea-php81 from v8.1.7 to v8.1.8 - (Heap buffer overflow in finfo_buffer). (CVE-2022-31627)- EA-10758: Update ea-php81 from v8.1.6 to v8.1.7- EA-10705: Update ea-php81 from v8.1.5 to v8.1.6- EA-10634: Update ea-php81 from v8.1.4 to v8.1.5- EA-10577: Update ea-php81 from v8.1.3 to v8.1.4- EA-10532: Update litespeed to 8.0.1- EA-10506: Update ea-php81 from v8.1.2 to v8.1.3- EA-10451: Update ea-php81 from v8.1.1 to v8.1.2- ZC-9600: Fix Ubuntu 21 global regs problem- ZC-9589: Update DISABLE_BUILD to match OBS- ZC-9587: Build php-sodium- EA-10366: Update ea-php81 from v8.1.0 to v8.1.1- ZC-9524: Released tarball- ZC-9479: Build php8.1 on Ubuntu- ZC-8130: Build php8.1hou-2 17889098328.1.34-3.8.3.cpanel8.1.34-3.8.3.cpanel8.1.34-3.8.3.cpanel20-fileinfo.inifileinfo.so.build-id27afc8c3cc4f2d3e0c8b3db3d8d58efeb6085b1a/opt/cpanel/ea-php81/root/etc/php.d//opt/cpanel/ea-php81/root/usr/lib64/php/modules//usr/lib//usr/lib/.build-id//usr/lib/.build-id/27/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectionobs://private/EA4-production/CentOS_8/3590cb579a2a46b575e6f8502f6becc2-ea-php81cpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=27afc8c3cc4f2d3e0c8b3db3d8d58efeb6085b1a, not strippeddirectory zy;͕'c2utf-88971c0411ae7653220c4e8f7610d699e47cab39790edddc330bc6099874b2399?Pj)#x~|D2s16zUҤE8g9ٳaSώD[c䁝IϏ[qOQ08ꁠ2N YxQ9yVN -];u _7Z@PvihhD/RF"1x&6:'b\q%7SgAEy@.h}z#UK&ق}jdf_?-4vO_K_<˝d~Oq"wovV5Cg o Bc0rgyP'ZSksp Ise$kr#`N I)~Vǀ 켣Y#]`|>]Ʋx~_I|Qn忷uKү0KOD֑fc'lI?v5o5rDefTlLX!BRe5{M(2)7̼kEq07"}; *E KC7 sa7*P/[7=@js-N/LU6CT\^z6LLJQ__IYQm3.pe):;Ҏf=K2:#*P: RcHz KD-@@R^W|Vv$jpSU#V\JH8eZq`_*n!4'*EQa@@MoW0HB.@&e 訉% mVd$M>-ihMeU"CugOgX{Yum8G[K7YefOpd,^14ˆGCM:o* ;6ad0c95d40028d29b7b0f00e40188c16183165d93670708d50d72ffd4ca50798160d2f9f96a6d9e3f815f874d73e4d82373cc24fj8mj8nding info and pdev cca stats (Jarod Wilson) [1807052] - [wireless] ath10k: move non-fatal warn logs to dbg level (Jarod Wilson) [1807052] - [wireless] ath11k: add spatial reuse support (Jarod Wilson) [1807052] - [wireless] ath11k: add TWT support (Jarod Wilson) [1807052] - [wireless] ath11k: add HE support (Jarod Wilson) [1807052] - [wireless] ath11k: Remove dead code while handling amsdu packets (Jarod Wilson) [1807052] - [wireless] ath11k: fix missed bw conversion in tx completion (Jarod Wilson) [1807052] - [wireless] ath11k: convert message from info to dbg (Jarod Wilson) [1807052] - [wireless] ath11k: ignore event 0x6017 (Jarod Wilson) [1807052] - [wireless] ath11k: add RX stats support for radiotap (Jarod Wilson) [1807052] - [wireless] ath11k: driver for Qualcomm IEEE 802.11ax devices (Jarod Wilson) [1807052] - [wireless] ath10k: fix RX of frames with broken FCS in monitor mode (Jarx0XLh,$&lidate semanage fcontext input - Fix template names for log files in gui- Fix template to generate correct content- Fix consolekit link to selinux-polgengui- Fix the generation templates- Fix enable/disable audit messages- Add booleans page- Lots of updates to gui- Remove no.po - Update to upstream * Fix semodule option handling from Dan Walsh. * Add deleteall support for ports and fcontexts in semanage from Dan Walsh.- Fix semodule parameter checking- Update to upstream * Add genhomedircon script to invoke semodule -Bn from Dan Walsh. - Add deleteall for ports and fcontext- Update to upstream * Update semodule man page for -D from Dan Walsh. * Add boolean, locallist, deleteall, and store support to semanage from Dan Walsh.- Add genhomedircon script to rebuild file_context for shadow-utils- Update translations- Additional checkboxes for application policy- Allow policy writer to select user types to transition to there users- Fix bug in building policy with polgengui - Creating ports correctly- Update to upstream * Improve semodule reporting of system errors from Stephen Smalley.- Show local changes with semanage- Fixed spelling mistakes in booleans defs - Update po- Update to upstream * Fix setfiles selabel option flag setting for 64-bit from Stephen Smalley.- Fix wording in policy generation tool- Fix calls to _admin interfaces- Upgrade version of sepolgen from NSA * Expand the sepolgen parser to parse all current refpolicy modules from Karl MacMillan. * Suppress generation of rules for non-denials from Karl MacMillan (take 3).- Remove bogus import libxml2- Lots of fixes for polgengui- Change Requires /bin/rpm to rpm- Bump libsemanage version for disable dontaudit - New gui features for creating admin users- Fix generated code for admin policy- Lots of fixes for role templates- Add more role_templates- Update genpolgui to add creation of user domains- Fix location of sepolgen-ifgen- Add selinux-polgengui to desktop- Cleanup spec- Update semodule man page * Fix genhomedircon searching for USER from Todd Miller * Install run_init with mode 0755 from Dan Walsh. * Fix chcat from Dan Walsh. * Fix fixfiles pattern expansion and error reporting from Dan Walsh. * Optimize genhomedircon to compile regexes once from Dan Walsh. * Fix semanage gettext call from Dan Walsh.- Update semodule man page- Update to match NSA * Disable dontaudits via semodule -D- Speed up genhomedircon by an order of magnitude by compiling regex - Allow semanage fcontext -a -t <> /path to work- Fixfiles update required to match new regex- Update booleans translations- rebuild for toolchain bug- Add requires libselinux-python- Fix fixfiles to report incorrect rpm - Patch provided by Tony Nelson- Clean up spec file- Require newer libselinux version- Fix checking for conflicting directory specification in genhomedircon- Fix spelling mistakes in GUI- Fix else path in chcat- Update to match NSA * Rebase setfiles to use new labeling interface.- Add filter to all system-config-selinux lists- Update to match NSA * Fixed setsebool (falling through to error path on success).- Update to match NSA * Merged genhomedircon fixes from Dan Walsh. * Merged setfiles -c usage fix from Dan Walsh. * Merged restorecon fix from Yuichi Nakamura. * Dropped -lsepol where no longer needed.- Fix translations code, Add more filters to gui- Fix setfiles -c to make it work- Fix french translation to not crash system-config-selinux- Fix genhomedircon to work in stage2 builds of anaconda- Update to match NSA- Fixes for polgentool templates file- Updated version of policycoreutils * Merged support for modifying the prefix via semanage from Dan Walsh. - Fixed genhomedircon to find homedirs correctly.- Updated version of policycoreutils * Merged po file updates from Dan Walsh. - Fix semanage to be able to modify prefixxH XL$ 59-2Dan Walsh 2.0.59-1Dan Walsh 2.0.58-1Dan Walsh 2.0.57-12Jesse Keating - 2.0.57-11Dan Walsh 2.0.57-10Dan Walsh 2.0.57-9Dan Walsh 2.0.57-8Dan Walsh 2.0.57-7Dan Walsh 2.0.57-6Dan Walsh 2.0.57-5Dan Walsh 2.0.57-4Dan Walsh 2.0.57-3Dan Walsh 2.0.57-2Dan Walsh 2.0.57-1Dan Walsh 2.0.56-1Dan Walsh 2.0.55-8Dan Walsh 2.0.55-7Dan Walsh 2.0.55-5Dan Walsh 2.0.55-4Dan Walsh 2.0.55-2Dan Walsh 2.0.55-1Dan Walsh 2.0.54-7Dan Walsh 2.0.54-6Dan Walsh 2.0.54-5Dan Walsh 2.0.54-2Dan Walsh 2.0.54-1Dan Walsh 2.0.53-3Dan Walsh 2.0.53-2Dan Walsh 2.0.53-1Dan Walsh 2.0.52-6Dan Walsh 2.0.52-5Dan Walsh 2.0.52-4Dan Walsh 2.0.52-3Dan Walsh 2.0.52-2Dan Walsh 2.0.52-1Dan Walsh 2.0.50-2Dan Walsh 2.0.50-1Dan Walsh 2.0.49-10Dan Walsh 2.0.49-8Dan Walsh 2.0.49-7Dan Walsh 2.0.49-6Dan Walsh 2.0.49-5Dan Walsh 2.0.49-4Dan Walsh 2.0.49-3Dan Walsh 2.0.49-2Dan Walsh 2.0.49-1Dan Walsh 2.0.47-3Dan Walsh 2.0.47-2Dan Walsh 2.0.47-1Matthias Clasen - 2.0.46-5Matthias Clasen - 2.0.46-4Dan Walsh 2.0.46-3Dan Walsh 2.0.46-2Dan Walsh 2.0.46-1Dan Walsh 2.0.44-1Dan Walsh 2.0.43-2Dan Walsh 2.0.43-1Dan Walsh 2.0.42-3Dan Walsh 2.0.42-2Dan Walsh 2.0.42-1Dan Walsh 2.0.41-1Dan Walsh 2.0.39-1Dan Walsh 2.0.38-1Dan Walsh 2.0.37-1Dan Walsh 2.0.36-2Dan Walsh 2.0.36-1Dan Walsh 2.0.35-5Dan Walsh 2.0.35-4Dan Walsh 2.0.35-3Dan Walsh 2.0.35-2Dan Walsh 2.0.35-1Dan Walsh 2.0.34-8Dan Walsh 2.0.34-7Dan Walsh 2.0.34-5Dan Walsh 2.0.34-4Dan Walsh 2.0.34-3Dan Walsh 2.0.34-2Dan Walsh 2.0.34-1Dan Walsh 2.0.33-4Dan Walsh 2.0.33-3Dan Walsh 2.0.33-2Dan Walsh 2.0.33-1Dan Walsh 2.0.32-2Dan Walsh 2.0.32-1Dan Walsh 2.0.31-20Dan Walsh 2.0.31-19Dan Walsh 2.0.31-18Dan Walsh 2.0.31-17Dan Walsh 2.0.31-16Dan Walsh 2.0.31-15Dan Walsh 2.0.31-14Dan Walsh 2.0.31-13Dan Walsh 2.0.31-12Dan Walsh 2.0.31-11Dan Walsh 2.0.31-10Dan Walsh 2.0.31-9Dan Walsh 2.0.31-8Dan Walsh 2.0.31-7Dan Walsh 2.0.31-6Dan Walsh 2.0.31-5Dan Walsh 2.0.31-4Dan Walsh 2.0.31-3Dan Walsh 2.0.31-1Dan Walx XPL(T$,TTTd fix it, use new settings, new size-changed cb - firewall-offline-cmd: Fix use of systemctl in chroot - firewall-config: use string.ascii_letters instead of string.letters - dbus_to_python(): handle non-ascii chars in dbus.String. - Modernize old syntax constructions. - dict.keys() in Python 3 returns a "view" instead of list - Use gettext.install() to install _() in builtins namespace. - Allow non-ascii chars in 'short' and 'description' - README: More information for "Working With The Source Repository" - Build environment fixes - firewalld.spec: Added missing checks for rhel > 6 for pygobject3-base - firewall-applet: New setting show-inactive - Don't stop on reload when lockdown already enabled (RHBZ#987403) - firewall-cmd: --lockdown-on/off did not touch firewalld.conf - FirewallApplet.gschema.xml: Dropped unused sender-info setting - doc/firewall-applet.xml: Added information about gsettings - several debug and log message fixes - Add chain for sources so they can be checked before interfaces (RHBZ#903222) - Add dhcp and proxy-dhcp services (RHBZ#986947) - io/Zone(): don't error on deprecated family attr of source elem - Limit length of zone file name (to 12 chars) due to Netfilter internals. - It was not possible to overload a zone with defined source(s). - DEFAULT_ZONE_TARGET: {chain}_ZONE_{zone} -> {chain}_{zone} - New runtime getSettings for services and icmptypes, fixed policies callbacks - functions: New functions checkUser, checkUid and checkCommand - src/firewall/client: Fixed lockdown-whitelist-updated signal handling - firewall-cmd(1): move firewalld.richlanguage(5) reference in --*-rich-rule - Rich rule service: Only add modules for accept action - firewall/core/rich: Several fixes and enhanced checks - Fixed reload of direct rules - firewall/client: New functions to set and get the exception handler - firewall-config: New and enhanced UI to handle lockdown and rich rules - zone's immutable attribute is redundant - Do not allow to set settings in config for immutable zones. - Ignore deprecated 'immutable' attribute in zone files. - Eviscerate 'immutable' completely. - FirewallDirect.query_rule(): fix it - permanent direct: activate firewall.core.io.direct:Direct reader - core/io/*: simplify getting of character data - FirewallDirect.set_config(): allow reloading- Remove migrating to a systemd unit file from a SysV initscript - Remove pointless "ExclusiveOS" tag- Fixed rich rule check for use in D-Bus- new service files - relicensed logger.py under GPLv2+ - firewall-config: sometimes we don't want to use client's exception handler - When removing Service/IcmpType remove it from zones too (RHBZ#958401) - firewall-config: work-around masquerade_check_cb() being called more times - Zone(IO): add interfaces/sources to D-Bus signature - Added missing UNKNOWN_SOURCE error code - fw_zone.check_source: Raise INVALID_FAMILY if family is invalid - New changeZoneOfInterface method, marked changeZone as deprecated - Fixed firewall-cmd man page entry for --panic-on - firewall-applet: Fixed possible problems of unescaped strings used for markup - New support to bind zones to source addresses and ranges (D-BUS, cmd, applet - Cleanup of unused variables in FirewallD.start - New firewall/fw_types.py with LastUpdatedOrderedDict - direct.chains, direct.rules: Using LastUpdatedOrderedDict - Support splitted zone files - New reader and writer for stored direct chains and rules - LockdownWhitelist: fix write(), add get_commands/uids/users/contexts() - fix service_writer() and icmptype_writer() to put newline at end of file - firewall-cmd: fix --list-sources - No need to specify whether source address family is IPv4 or IPv6 - add getZoneOfSource() to D-Bus interface - Add tests and bash-completion for the new "source" operations - Convert all input args in D-Bus methods - setDefaultZone() was calling accessCheck() *after* the action - New uniqify() function to remove duplicates from list whilst preserving order - Zone.combine() merge also services and ports - config/applet: silence DBusException xXFL BT$"TTTpa-trust service - fix: core: rich: Catch ValueError on non-numeric priority values - fix(rich): icmptypes with one family - fix(direct): rule in a zone chain - plus additional upstream stable fixes- rebase to v0.8.2- doc: direct: add CAVEATS section- restore zone drifting as a feature- fix: CLI: service: also output helpers for service info- rebase to v0.8.0- bump nftables version requirements- backport patches to sort source-based zone dispatch by zone name- backport patch to show service includes in service output - backport patches to fix dbus API break- package rebuild- rebase to v0.7.0- backport additional patches for RFC3964_IPv4 filter feature- backport nftables support for wildcard interfaces - backport RFC3964_IPv4 filter feature- backport fix for lost NM interfaces in default zone during reload- backport recent stable fixes - backport fix for lost NM interfaces during reload - backport rich rule priorities - backport fix for set entries not applied - update translations- backport FlushAllOnReload feature- use py3_shbang_opts for lockdown-whitelist - fix cockpit patch causing test failure- rebase package to v0.6.3 - use py3_shbang_opts for interpreter invocations- python3-firewalld can get by with python3-gobject-base - firewall-config can get by with python3-qt5-base- backports for new failed state if startup fails - backports to use explicit RETURN on user defined ebtables chains - backports to fix nftables AUDIT log support- drop support for ebtables broute table- add more ports to high-availability service- rebase to v0.6.1 - fix patch adding cockpit by default, fixes testsuite- Use correct conflicts version for cockpit-ws - Enable cockpit by default in some zones- rebase to v0.6.0- rebase to v0.6.0-alpha- remove fedora-isms and clean up spec file- remove python2-firewall subpackage- rebase package to v0.5.2- Escape macros in %changelog- rebase package to v0.5.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Remove obsolete scriptlets- Python 2 binary package renamed to python2-firewall See https://fedoraproject.org/wiki/FinalizingFedoraSwitchtoPython3- Fix spec file for next RHEL versions- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebase to firewalld-0.4.4.5 http://www.firewalld.org/2017/06/firewalld-0-4-4-5-release - Fix build from spec - Fix –remove-service-from-zone option (RHBZ#1438127) - Support sctp and dccp in ports, source-ports, forward-ports, helpers and rich rules (RHBZ#1429808) - firewall-cmd: Fix –{set,get}-{short,description} for zone (RHBZ#1445238) - firewall.core.ipXtables: Use new wait option for restore commands if available - New services for oVirt: ctdb, ovirt-imageio, ovirt-storageconsole, ovirt-vmconsole and nrpe - Rename extension for policy choices (server and desktop) to .policy.choice (RHBZ#1449754) - D-Bus interfaces: Fix GetAll for interfaces without properties (RHBZ#1452017) - Load NAT helpers with conntrack helpers (RHBZ#1452681) - Translation updates - Additional upstream patches: - Rich-rule source validation (d69b7cb) - IPv6 ICMP type only rich-rule fix (cf50bd0)- Rebase to firewalld-0.4.4.4 http://www.firewalld.org/2017/03/firewalld-0-4-4-4-release - Drop references to fedorahosted.org from spec file and Makefile.am, use archive from github - Fix inconsistent ordering of rules in INPUT_ZONE_SOURCE (issue#166) - Fix ipset overloading from /etc/firewalld/ipsets - Fix permanent rich rules using icmp-type elements (RHBZ#1434594) - firewall-config: Deactivate edit, remove, .. buttons if there are no items - Check if ICMP types are supported by kernel before trying to use them - firewall-config: Show invalid ipset type in the ipset configuration dialog in a special label- Fixed ipset overloading, dropped applied check in get_ipset (issue#206)- Rebase to firewalld-0.4.4.3 http://www.firewalld.org/2017/02/firewalld-0-4-4-3-release - Speed up of large file loading - Support for more ipset types - Speed up of addinxXL);$ ;;;ase 5.04 - Updates local patches so that they apply cleanly to avoud hunk errors- New upstream realease 5.03- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- rhbz#1108818: New upstream realease 5.02 - Updated local patches - The rhbz#530950 is tested and seems to work. STRLEN has been no longer allocated statically since 4.36 version. So it is possible that this bz might have got fixed around 4.36 release. - Fixes rpmlint errors- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Integration with systemd. - Spec file clean up - Patched stunnel systemd unit file to have dependency on network.target. - rhbz#455815: Packaged systemd service file - rhbz#782535: Fixed private tmp issue. - rhbz#995831: Fixed wrong encoding of french man page.- New upstream realease 5.01 - Supports OpenSSL DLLs 1.0.1g. - Fixes to take care of OpenSSL,s TLS heartbeat read overrun (CVE-2014-0160).- New upstream realease 5.00 - Updated local patches. - Fix for CVE-2014-0016 - Fixed changelog date errors - Fixes rhbz #1006819- Ftp mirrors for NA does not work, so changing source code URLs to the correct ones.- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- New upstream realease 4.56. - Updated local patches. - Fixed upstream URL in spec file. - Sourced URL of sha256 hash file in spec file.- Resolves: 927841- New upstream realease 4.55 - Updated local patches - enabled fips mode - Fixed for pod2man as it build-requires perl-podlators- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- 884183: support for full relro.- New upstream realease 4.54 - Updated local patches- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- New upstream realease 4.53 - Updated local patches- New upstream realease 4.52 - Updated local patches- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- New upstream realease 4.50 - Updated local patches- New upstream realease 4.44 - Updated local patches- New upstream realease 4.42 - Updated local patches - Fixes #732069- New upstream realease 4.41 - Updated local patches to match the new release- New upstream realease 4.37 - Updated local patches to match the new release- New upstream realease 4.35 - Updated authpriv and sample patches to match the new release- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- New upstream realease 4.34 - Updated authpriv and sample patches to match the new release- New upstream realease 4.33 - Updated authpriv and sample patches to match the new release - Addresses bz 580117 (inted mode support issue)- New upstream realease 4.32 - Updated authpriv and sample patches to match the new release- New upstream realease 4.31 - Updated authpriv and sample patches to match the new release- New upstream realease 4.30 - Updated authpriv and sample patches for the new release- New upstream realease 4.29 - Updated authpriv and sample patches for the new release - Modified spec file to include dist tag- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Fix the previous patch.- Avoid aliasing undefined by ISO C- Update to stunnel-4.27.- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- disable openssl upstream fips mode- Update to stunnel-4.26.- Use a clearer error message if the service name is unknown in "accept" Resolves: #450344- Update to stunnel-4.25- Drop stunnel3 Resolves: #442842- Update to stunnel-4.24- Update to stunnel-4.22- Autorebuild for GCC 4.3- Rebuild with openssl-0.9.8g- Revert the port to NSS, wait for NSS-based stunnel 5.x instead Resolves: #301971 - Mark localized man pages with %lang (patch by Ville Skyttä) Resolves: #322281- Port to NSS- Update BuildRequires for the separate tcp_wrappers-devel package- Update to stunnel-4.20- Update to stunnel-4.19- Update to stunnel-4.18 - Remove unused stunnel.cnf from the src.rpm - Fix some rpmlint warnings- rebuilt with latest binutils to pick up 64K -z commonpagesize onx@b(XZLQh-$xh-i-G>?9d  Y  DZ}$$ d$ $ <$  `$  $ `$ $  $x(>8H494:4G,@$H,$I-`$X-Y-\-$].@$^0 b0d1e1f2l2t2$u2$v3<w7$x8 $y8/9l9p9v9996< <6 >L>u>>$>g>h>Csocat1.7.4.12.el8_10Bidirectional data relay between two data channels ('netcat++')Socat is a relay for bidirectional data transfer between two independent data channels. Each of these data channels may be a file, pipe, device (serial line etc. or a pseudo terminal), a socket (UNIX, IP4, IP6 - raw, UDP, TCP), an SSL socket, proxy CONNECT connection, a file descriptor (stdin etc.), the GNU line editor (readline), a program, or a combination of two of these.hv jx64-builder03.almalinux.orga7AlmaLinuxAlmaLinuxGPLv2AlmaLinux Packaging Team Applications/Internethttp://www.dest-unreach.org/socat/linuxx86_64zJhY=F#D  -9z  ?!L%%AAAAA큤hv jhv jhv jhv jhv jhv jhv jhv jhv jhv jhv jW>shv ]XoW>s_ _ \NjW>s_ W>shv ihv ihv ihv ihv ihv ihv ihv ihv ihv ihv ihv ihv ihv ihv i5a82d9ca7f7e0f804c316f455458377ceaf0498e5cabedadf397559937011c70915bd5a94262108b4d3797bdae0e83ffc5428bf108ddc6a0fb2a53f9ee3fdcf8ce6b162a078cc7a3bbf802aad9394cef2270b69b2d816a76b61581e25d67e12758c9028236750fa5415223d91463900c1d49f68c7ba540b7b2f97d0fe172a45de6ea00c6aecf2d58bbb784052a44ddc965e0a556294448f51204e61141ba7baf8177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643fd9e48ca316a5032069b9521f4f4b4d9b1c60365012bae1e62286bcd5bd2e761be1a625b91626279f02e41200fdec333f1138401733fa5b157ffea1de53ceaddcc78462383852ca6899849d974d3654b2ac2e6c56713e19376e4938bd52f2cfcb44309ba0d20a969f9b72b5b38263c78f661f08bba11be106642b50907e19cc58702d3954da88d7851d4cf5c25b73f100a5ac13bc990fbb2954dad68cd0d1be5b1ebebbce145027f4268211f36d121b083aeeabdc1736eb144b8afd8e86ce8dae1799204b2c51525ee37058ceee638ecc0fb0be5603fd2adefb11f8a0b23ac3e3824375d0516dbd1a7d353414984d932a550fd908e960b48f79033bc5d82dc71a2298ac5f9e43785385f02038dcc5af7db68f29695a8f3749953935b00ef7d9088a53e41b8a18ba76da7bc45e781ecb7064aa29126dd0a0001add31f6ded8106935549c5969e5883b400784f7fea604f16e116231f817dc5a675d9a59dcbffceb9b8ee5f15bac719de9eb7224111ffdca302908b4b5276f58b0d01e0915a127cbcde64e15332f2835dcdc14b8e71f448cd60ec2054e0ba6d79b15e0d825a18ffc4a646444e9ab026660452a1a1181474052d7e635b8d8729fcb73a171f700d3aba2933506c7170497f7f7a5c53dc281cca28934e6b95b00002bdc84d76f14ea1b161234f692b28627d1ba7070bc75eca53da89fe55dd8660039c39697b6c931644912a06b55f2b638127efeb6ad16478189e87aba803fa071da9240bb37669d918c4cf91194e3e09a74019cc6077cbc75f3ec573b497d6983f44b4c2e714ca7aefb0d88ea50b3cfb5e262622b1a60261a2f38ad0aae2b0795cea28c5820648458a1d96eee8bedac4b68ab8ec9facdd7574fa9e3070242bdb7578c2f5531623af8a1d96eee8bedac4b68ab8ec9facdd7574fa9e3070242bdb7578c2f5531623afa457d6e6cf4c5e5db078fa4ed0d782ebb47a7e0bef6f6f26574cfe6cca67a22b../../../xpXSL0RpfT$/TTTtranslation updates: cs, hu, ja- tests/firewalld_config.py: tests for config.service and config.icmptype - FirewallClientConfigServiceSettings(): destinations are dict not list - service/zone/icmptype: do not write deprecated name attribute - New service ntp - firewall-config: Fixed name of about dialog - configure.in: Fixed getting of error codes - Added coding to all pyhton files - Fixed copyright years - Beautified file headers - Force use of pygobject3 in python-slip (RHBZ#874378) - Log: firewall.server.config_icmptype, firewall.server.config_service and firewall.server.config_zone: Prepend full path - Allow ":" in interface names for interface aliases - Add name argument to Updated and Renamed signal - Disable IPv4, IPv6 and EB tables if missing - for IPv4/IPv6 only environments - firewall-config.glade file cleanup - firewall-config: loadDefaults() can throw exception - Use toolbars for Add/Edit/Remove/LoadDefaults buttons for zones, services and icmp types - New vnc-server service, opens ports for displays :0 to :3 (RHBZ#877035) - firewall-cmd: Fix typo in help output, allow default zone usage for permanenent options - Translation updates: cs, fr, ja, pt_BR and zh_CN- firewall-config: some UI usability changes - firewall-cmd: New option --list-all-zones, output of --list-all changed, more option combination checks - firewall-applet: Replaced NMClient by direct DBUS calls to fix python core dumps in case of connection activates/deactivates - Use fallback 'C' locale if current locale isn't supported (RHBZ#860278) - Add interfaces to zones again after reload - firewall-cmd: use FirewallClient().connected value - firewall-cmd: --remove-interface was not working due to a typo - Do not use restorecon for new and backup files - Fixed use of properties REJECT and DROP - firewalld_test.py: check interfaces after reload - Translation updates - Renamed firewall-convert-scfw-config to firewall-offline-cmd, used by anaconda for firewall configuration (e.g. kickstart) - Fix python shebang to use -Es at installation time for bin_SCRIPTS and sbin_SCRIPTS and at all times in gtk3_chooserbutton.py - tests/firewalld_config.py: update test_zones() test case - Config interface: improve renaming of zones/services/icmp_types - Move emiting of Added signals closer to source. - FirewallClient(): config:ServiceAdded signal was wrongly mapped - Add argument 'name' to Removed signal - firewall-config: Add callbacks for config:[service|icmp]-[added|removed] - firewall-config: catch INVALID_X error when removing zone/service/icmp_type - firewall-config: remove unused code - Revert "Neutralize _xmlplus instead of conforming it" - firewall-applet: some UI usability changes - firewall-cmd: ALREADY_ENABLED, NOT_ENABLED, ZONE_ALREADY_SET are warnings- Do not apply old settings to zones after reload - FirewallClient: Added callback structure for firewalld signals - New firewall-config with full zone, service and icmptype support - Added Shields Up/Down configuration dialog to firewall-applet - Name attribute of main tag deprecated for zones, services and icmptypes, will be ignored if present - Fixed wrong references in firewalld man page - Unregister DBus interfaces after sending out the Removed signal - Use proper DBus signature in addIcmpType, addService and addZone - New builtin property for config interfaces - New test case for Config interface - spec: use new systemd-rpm macros (rhbz#850110) - More config file verifications - Lots of smaller fixes and enhancements- use new systemd-rpm macros (rhbz#850110)- Update of firewall-config - Some bug fixes- New D-BUS interface for persistent configuration - Aded support for persistent zone configuration in firewall-cmd - New Shields Up feature in firewall-applet - New requirements for python-decorator and pygobject3 - New firewall-config sub-package - New firewall-convert-scfw-config config script- Fixed traceback in firewall-cmd for failed or canceled authorization, return proper error codes, new error codes NOT_RUNNING and NOT_AUTHORIZED - Enhanced fxXL9$"999nalin@redhat.com>Nalin Dahyabhai 1.10.3-4Nalin Dahyabhai 1.10.3-3Nalin Dahyabhai 1.10.3-2Nalin Dahyabhai 1.10.3-1Nalin Dahyabhai 1.10.2-7Nalin Dahyabhai 1.10.2-6Nalin Dahyabhai 1.10.2-5Fedora Release Engineering - 1.10.2-4Nalin Dahyabhai 1.10.2-3Nalin Dahyabhai 1.10.2-2Nalin Dahyabhai 1.10.2-1Nalin Dahyabhai Nalin Dahyabhai 1.10.1-3Nalin Dahyabhai 1.10.1-2Nalin Dahyabhai 1.10.1-1Nalin Dahyabhai 1.10-5Nathaniel McCallum - 1.10-4Nathaniel McCallum - 1.10-3Nalin Dahyabhai 1.10-2Nalin Dahyabhai 1.10-1Nathaniel McCallum - 1.10-0.beta1.2Nalin Dahyabhai 1.10-0.beta1.1Peter Robinson Nalin Dahyabhai 1.10-0.alpha2.2Nalin Dahyabhai 1.10-0.alpha2.1Nalin Dahyabhai 1.10-0.alpha1.3Nalin Dahyabhai 1.10-0.alpha1.2Nalin Dahyabhai 1.10-0.alpha1.1Nalin Dahyabhai 1.10-0.alpha1.0Fedora Release Engineering - 1.9.1-19Nalin Dahyabhai 1.9.1-18Nalin Dahyabhai 1.9.1-17Nalin Dahyabhai 1.9.1-16Tom Callaway 1.9.1-15Tom Callaway 1.9.1-14Tom Callaway 1.9.1-13Nalin Dahyabhai 1.9.1-12Nalin Dahyabhai 1.9.1-11Nalin Dahyabhai 1.9.1-10Nalin Dahyabhai 1.9.1-9Nalin Dahyabhai 1.9.1-8Nalin Dahyabhai 1.9.1-7Nalin Dahyabhai 1.9.1-6Nalin Dahyabhai 1.9.1-5Nalin Dahyabhai 1.9.1-4Nalin Dahyabhai 1.9.1-3Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai 1.9.1-2Nalin Dahyabhai Nalin Dahyabhai 1.9.1-1Nalin Dahyabhai 1.9-9Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai 1.9-8Nalin Dahyabhai 1.9-7Nalin Dahyabhai Nalin Dahyabhai 1.9-6Nalin Dahyabhai 1.9-5Nalin Dahyabhai 1.9-4Fedora Release Engineering - 1.9-3Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai 1.9-2Nalin Dahyabhai 1.9-1Nalin Dahyabhai 1.9-0.beta3.1Nalin Dahyabhai 1.9-0.beta3.0Nalin Dahyabhai 1.9-0.beta2.0Nalin Dahyabhai 1.9-0.beta1.1Nalin Dahyabhai 1.9-0.beta1.0Nalin Dahyabhai 1.8.3-8Nalin Dahyabhai 1.8.3-7Nalin Dahyabhai 1.8.3-6jkeating - 1.8.3-5Nalin Dahyabhai 1.8.3-4Nalin Dahyabhai 1.8.3-3Nalin Dahyabhai 1.8.3-2Nalin Dahyabhai 1.8.3-1Nalin Dahyabhai 1.8.2-3Nalin Dahyabhai 1.8.2-2Nalin Dahyabhai Nalin Dahyabhai 1.8.2-1Nalin Dahyabhai 1.8.1-7Nalin Dahyabhai Nalin Dahyabhai 1.8.1-6Nalin Dahyabhai 1.8.1-5Nalin Dahyabhai 1.8.1-4Nalin Dahyabhai 1.8.1-3Nalin Dahyabhai 1.8.1-2Nalin Dahyabhai 1.8.1-1Nalin Dahyabhai Nalin Dahyabhai \`4ll_RiVg֞D_3\}i wg$CMuRݺ֥pvM&#IT׭Ų=ͩ2rjBT{Y#VjG 9ݜиL^Ai:IFhŷ݋PӔPǓS|ً3!^P,*%hv?P *%cbB*Z$7ąX{SmrkMq͇GÁ'̩Y3*SL 1хF616E7hPc: abI&Hb8iUo [Fwpe3PQ:H]}hl(Dɽ߹u9P'C9-O@Nap9Ƥ^<+f43LLw A480c732b7739f4ead80ee3884672f2858dfdf248c7efe2ab677951edbf6af3084cd996c3d12429e4173fdf8a431574abb0f41872j{yvtj{xssQ3w3&eaa462a7df74ac37c2696a9432c24bc041d1c7QYddeasy_install.cpython-39.pycQWI eapilib.pyQWIeapilib.cpython-39.pycIQ+ec2.pyM11Q+ec2.cpython-39.pycQ7+Eebs.py8.sQ3+ebs.cpython-39.pycQ%sec.pyiQeaster.cpython-39.pycQZQec.pyQGQsec.cpython-39.pycMZe&eafc8135c18123e33abc126596f2798c2fae7d[-easy_install.txtc--9easy_install.pyo--_easy_install.pyc2--Qpd9easy_install.py-4easy_install-2669-&eadd32bae2bb25d417c9c1c246cf6fba760ba696w( 2easy-install.pth7-2easy_install-2.7d2 easy_installcd ec.1ssl.gzcf6Rcec.png64eg8 ebtables.8.gzg3ebtables-nft.8.gzg6 ebtables-saveg2ebtables-restoredgcebtables.serviceg6ebtables-config8aggg4ebtablesTb&eafa8bd83122be28ac65b813c3536bb086973ek&ec286339af4577c1ef88f0d5726f3c0662d19ainemQ_ec2-instance-connect@}lQ Q QQ%Q/eec2ea 3% &eec.hl0].)"pec-36WB ebtables.h-phWAn ebt_vlan.heW@o ebt_stp.hW?eebt_redirect.hn__W>. ebt_pkttype.hW=; ebt_nflog.h1-W<: ebt_nat.hW;m ebt_mark_t.h-W:- ebt_mark_m.h8W9h ebt_log.hW8e ebt_limit.h6W7h ebt_ip6.hW65ebt_ip.hhW5tebt_arpreply.h-phW4 ebt_arp.hW3 ebt_among.hphW2m ebt_802_3.htfQoebspnyl ebitmap.h3$%vebcdic.h`e&ebb65c359376c2ab8517e5f1e06dd423e9fc88-t&eb783c24d31f84ecc7b6b11d9ac056b21e25efn-31Z&eb185c5861c3922a1053a675725e12ce00c702e&eb09c15bf821589b97cd4b82c5253e7ed23399-ph-&eb015ab55ade2372e4be92190781abcb7d6d09li.8'1^>5>!Qwebf 56D- eaw_table.he. Q&p easter.pyi Qo easter.py +easter.cpython-36.pyc heaster.cpython-36.opt-1.pyce  earthris.giftearthquake-line.svg\tearthquake-fill.svg e earthmenu.png e earth.gif}earth-line.svgle-|gearth-fill.svgle-Zr_ eaccess.3.gz-&eabab726c95d5a1e3d225b4e7faf1da2b950bbs &eaae9febeb0adc702b15a629751e1f3a19e98db9be&eaa0b13e7bde95dc0f243bda9e61d00bd1d6861Lea_sync_user_phpini_settingshNa ea_php_cli.pmK.ea_install_profile6.pJcea_current_to_profilexhXhL(x$hxwy834 - Resolves: rhbz#1576921 - Resolves: rhbz#1270295 - Resolves: rhbz#1361698 - Resolves: rhbz#1369847 - Resolves: rhbz#1368651 - Resolves: rhbz#1563841 - Resolves: rhbz#1387622 - Resolves: rhbz#1575998 - Resolves: rhbz#1577854 - Resolves: rhbz#1387622 - Resolves: rhbz#1542416 - Resolves: rhbz#1542416 - Resolves: rhbz#1496153 - Resolves: rhbz#1568366 - Resolves: rhbz#1539803 - Resolves: rhbz#1552576 - Resolves: rhbz#1545075 - Resolves: rhbz#1544359 - Resolves: rhbz#1547672 - Resolves: rhbz#1537957 - Resolves: rhbz#1542920 - Resolves: rhbz#1507129 - Resolves: rhbz#1512956 - Resolves: rhbz#1512663 - Resolves: rhbz#1247083 - Resolves: rhbz#1247083 - Resolves: rhbz#1247083 - Resolves: rhbz#1519325 - Resolves: rhbz#1492036 - Resolves: rhbz#1391911 - Resolves: rhbz#1391911 - Resolves: rhbz#1479330 - Resolves: rhbz#1505185 - Resolves: rhbz#1305232- Improve performance for excludes and includes handling (RHBZ #1500361) - Fixed problem of handling checksums for local repositories (RHBZ #1502106) - Fix traceback when using dnf.Base.close() (RHBZ #1503575)- Update to 2.7.4-1 - Enhanced performance for excludes and includes handling - Solved memory leaks at time of closing of dnf.Base() - Resolves: rhbz#1480979 - I thought it abnormal that dnf crashed. - Resolves: rhbz#1461423 - Memory leak in python-dnf - Resolves: rhbz#1499564 - dnf list installed crashes - Resolves: rhbz#1499534 - dnf-2 is much slower than dnf-1 when handling groups - Resolves: rhbz#1499623 - Mishandling stderr vs stdout (dnf search, dnf repoquery)- Fix URL detection (RHBZ #1472847) - Do not remove downloaded files with --destdir option (RHBZ #1498426) - Fix handling of conditional packages in comps (RHBZ #1427144)- Update to 2.7.2-1 - Added new option ``--comment=`` that adds a comment to transaction in history - :meth:`dnf.Base.pre_configure_plugin` configure plugins by running their pre_configure() method - Added pre_configure() methotd for plugins and commands to configure dnf before repos are loaded - Resolves: rhbz#1421478 - dnf repository-packages: error: unrecognized arguments: -x rust-rpm-macros - Resolves: rhbz#1491560 - 'dnf check' reports spurious "has missing requires of" errors - Resolves: rhbz#1465292 - DNF remove protected duplicate package - Resolves: rhbz#1279001 - [RFE] Missing dnf --downloaddir option - Resolves: rhbz#1212341 - [RFE] Allow plugins to override the core configuration - Resolves: rhbz#1299482 - mock --init fails with message "Failed calculating RPMDB checksum" - Resolves: rhbz#1488398 - dnf upstream tests failures on f26 - Resolves: rhbz#1192811 - dnf whatprovides should show which provides matched a pattern - Resolves: rhbz#1288845 - "dnf provides" wildcard matching is unreliable (not all packages with matches listed) - Resolves: rhbz#1473933 - [abrt] dnf-automatic: resolved(): rpm_conf.py:58:resolved:AttributeError: 'Rpmconf' object has no attribute '_interactive' - Resolves: rhbz#1237349 - dnf autoremove not removing what dnf list extras shows - Resolves: rhbz#1470050 - the 'priority=' option in /etc/yum.repos.d/*.repo is not respected - Resolves: rhbz#1347927 - dnf --cacheonly downloads packages - Resolves: rhbz#1478115 - [abrt] dnf: _hcmd_undo(): __init__.py:888:_hcmd_undo:IndexError: list index out of range - Resolves: rhbz#1461171 - RFE: support --advisory= with install - Resolves: rhbz#1448874 - "dnf needs-restarting" vanished from bash completion - Resolves: rhbz#1495116 - Dnf version fails with traceback in container- Fix problem with dnf.Package().remote_location() (RhBug:1476215) (Jaroslav Mracek) - Change behavior of -C according to documentation (RhBug:1473964) (Jaroslav Mracek) - It should prevent to ask attribute of None (RhBug:1359482) (Jaroslav Mracek) - Solve a problems with --arch options (RhBug:1476834) (Jaroslav Mracek) - Use security plugin code for dnf-automatic (Jaroslav Mracek) - Fix unicode error for python2 (Jaroslav Mracek) - Inform about packages installed for group (Jaroslav Mracek) - Provide info if pkg is removed due to dependency (RhBug:1244755) (JaroxhwXhLXsA$QA@B - 1:0.17-59Fedora Release Engineering - 1:0.17-58Michal Sekletar - 1:0.17-57Michal Sekletar - 1:0.17-56Fedora Release Engineering - 1:0.17-55Fedora Release Engineering - 1:0.17-54Adam Tkac 1:0.17-53Fedora Release Engineering - 1:0.17-52Adam Tkac 1:0.17-51Adam Tkac 1:0.17-50Fedora Release Engineering - 1:0.17-49Karsten Hopp 1:0.17-48Adam Tkac 1:0.17-47Adam Tkac 1:0.17-46Adam Tkac 1:0.17-45Fedora Release Engineering - 1:0.17-44Fedora Release Engineering - 1:0.17-43Fedora Release Engineering - 1:0.17-42Adam Tkac 1:0.17-41Adam Tkac 1:0.17-40Harald Hoyer - 1:0.17-39Adam Tkac - 1:0.17-38.fc7Harald Hoyer - 1:0.17-37Jesse Keating - 1:0.17-36.1Harald Hoyer - 1:0.17-36Jesse Keating - 1:0.17-35.2.1Jesse Keating - 1:0.17-35.2Jesse Keating Harald Hoyer - 1:0.17-35Harald Hoyer Harald Hoyer - 1:0.17-33Jason Vas Dias - 1:0.17-31Harald Hoyer - 1:0.17-30Elliot Lee Elliot Lee Harald Hoyer - 1:0.17-27Elliot Lee Harald Hoyer 1:0.17-26Harald Hoyer 0.17-25Tim Powers Harald Hoyer 0.17-24Harald Hoyer 0.17-23Harald Hoyer Tim Powers Tim Powers Tim Powers Harald Hoyer 0.17-20Bill Nottingham Bill Nottingham Harald Hoyer Tim Powers Bill Nottingham Bill Nottingham Harald Hoyer Jakub Jelinek Pekka Savola Helge Deller Nalin Dahyabhai Trond Eivind Glomsrød Bill Nottingham Prospector Jeff Johnson Trond Eivind Glomsrød Trond Eivind Glomsrød Jeff Johnson Bernhard Rosenkraenzer Jeff Johnson Bill Nottingham Preston Brown Cristian Gafton Bill Nottingham Jeff Johnson Matt Wilson Preston Brown Jeff Johnson Bill Nottingham Jeff Johnson Antti Andreimann Jeff Johnson Jeff Johnson Jeff Johnson Jeff Johnson Erik Troan Cristian Gafton Jeff Johnson Prospector System Cristian Gafton Erik Troan Donnie Barnes Erik Troan - Resolves: #1895387 - telnet crashes on stack overflow due to infinite recursion- Resolves: #1881335 - in.telnetd needs to tolerate temporary EIO errors- Resolves: #1814474 - Arbitrary remote code execution in utility.c via short writes or urgent data- Resolves: #1602711 - Please review important issues found by covscan - Resolves: #1637085 - Option -i is missing in telnet in el8 but is available in el7- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_xXgX L~^D$N^D]D_Da1dd54715cfdac75492e517b083af551850b3b4bb1de9e27a1690c14ae9f442dbc1742a738e44ecb2566ee5f41832c5ba19f351d040f3a6823af8deef28df7bc0fca08e596ab197502f04392484de5d90962bfe4183faba8fec1e872140d03ffefc0d9613cc69efa3db126c4ce3e35f25e909fd024117b6b4060eadb00e8a2e1347479a910d2da18aa09a53e992802106f415d349f40e691d0d32de7b2afeb24d94dbd5190dac1381f3b85ce1cc0a997e19eda0bb58a0605fe38caa29e2842902a07adab76a7430462daec6442e405f2dbb76b3d1beff1fdc58317420bf146cd089136f7765da7dcd74820dec46ca5ce468a64be29898c2d7b191993cb260bed9d9d3e495828f91bd47426cce2aa4a42a7655570deea3591578f169f3ad1b3a84216e73c5279044c72002c9f3ebc7b3b79364e496294272172843f19c425d4f0d4425ed26ed62f7f6d8d8cc054bd759b7f25eb7c2b0aac2ae32ae0d62290b60ffb32d3c8465756b7563579ef57542f9c9747b17925f5c05c05122db91abc87c1cdbe1dcaeb46b7e9fb862124de6b833fa15da0a17a4259676593285bd612b99ee4a0ce181af768d23d464ed48f4927acbea778980543856cc9b1f89877f96e59f44427be04f8baa9cf8860fcde3d101410bb61d95f1d37df998d68db3be074717ddf8dbfda1e911efb80cf22ebad64e30c74766c0da24a084b1261056b85f774170fc1526e8a909a1e2952423dae3891b721abc293a27dc450818dcc6dd8469bc1c9375625b62c93847e6e1505598d825bb29d176a5a5f028f0e6a45d08d39211d4948fe77c483d45f953ea983c0e11c120ababe634fdc696300106fa21f5937d4c1735e2f87b1fc722378f29deeffc4cc9767d7c9e42d2f707e8bf79b3894eee02955f0c3253d1ce1303035f8e5e342be81660c2044215cebe6d8e93269997f35044955d76a14361f4751a5aca361d3edca6ba2007368ee7c7e8c024ffd2b2cdc34380430800d52917ef508bd03dd9c1a8ba60375b5413801e20f38ac8526ca756290d468e390f0c3b8b06c56068c1ea71c7d0f44bffd95a2efb66a432410b73208fdb5addbf85c6f245207c07b1e4f0f0d3771c7a297413205f93161a49eb0ebdcd564a3050bd0df6158f8586791e1ba9a2fc63ff8109e8b9b6a492f7f1a36f508f43c9f5613e0b167f4cebec3e6efba4c24e09eff2473fa7261f1d24734b8dec0ae60fb4922fff38ff1f31c0d854eb685e26645130db17153e36c48b0ccc40066ba04bba9afd68a002ace2b1adedde2f16caa044b7b5b1d2c167b26e7567e5fc5892eb1c23b82d3bcfc2a1e2c8eb6e499bac24e641ff300a066cbe3a8e49f04133afdbbcf18b1039f9b9fdd912729ce5d6dc89eacecde2a8263a82cce07fdaefbf422068d81ad11db84e97e5293e623815707b1bff37ee5089a38f8d139cbf6038f8b03e870727a101aa89a7891bc745e92aaf15ba0bbb6007c084c82a6c5dd6b6a0804efa2fc0f301705d86742198db6773fe5df926c2e53cff3dd6495c2b7886aec625d3a16ed176cff45f0559b70a15826f4caf445cfef786228cd7b8343937d98653b3a2f698fcc5dc3aff3a6b523d2cce5307d6eead5006602808e2a1f26cbfd2e26830f26179365312d0a167bfc11365cd553c8670718279d5f6f6459d14cdd4693f908f83dedf713d6e200d2f2334919abb473897b8f5ab1c1e33917c5669b65694002cb9359ae03841f8900c071e577e2d0739510fc4b1d93d14f0452e1c3fa0a6876a21866abeba525f550bda7f025339670eb9e4daf301e64f5acf2cf8db9eacd451e5bb30e48046ba237be972664a7ae1da0930e7bde62609d73ddf830146249bf4ee97b8c3c419ac88be20369e16145f9bb5f952b42c1e33917c5669b65694002cb9359ae03841f8900c071e577e2d0739510fc4b1d93d14f0452e1c3fa0a6876a21866abeba525f550bda7f025339670eb9e4daf301e64f5acf2cf8db9eacd451e5bb30e48046ba237be972664a7ae1da0930e7bde2078a27b08b367a461e32e293d4acb768e567b5efca70bb324fa49503fda8d7d5f8fb54b0694cfe66f1c810cd60833890cbcf2ea3e5d1e370edd3ef58f04fbefa1fea709a190fb62d544b30db9273c52a7107b9a27c53f210087521fe9150e3b0fa3553aac78e43d5a75220208aca267c6dc236a58a6ec308e80492f306fe5ae27ff93da0daaed8f90bc66104c4818245898c69803d5b62f14d0640d9a4d3384213d3dbc2e230e02192d6a093eaa8f7a5319cf266d0058f20c1f5266275b1542ba859b4e92fa139bed3b05e47902e5db6033cb4498e920b194303f808b289e4aef5e9950905426e9e3d94f0c3a784872fde40155e03c60f61d9b16897ab1528613523b0ae3cd1763907f4d4d506b3bb8f3a2d277e8cbfb317593624f7eb4c10f36f5d2a38700a8cecb130ad57f820372913c3ec0ee55f92a5c9dfee051ee75bd86cf57c9d092f86ddd70a98affa0e51af5997bb04423169a89ac1d2b15a8546a523b2630f1c009dc53514527d6028063188d6612a0ca9677113017d5ef4828ea120cb16dcf9180468912bc8defba090f4d16faa4d8d82d9ff1a20c293420a95e977f35b76c91e520e520c7374176c7b785a976a9d840999f801d5cc69a96c5510be3834ece2f2cbf9acc8ec18b668fa3a2406a05c806d9f917f84c78e78c310bdffa3d745de36b9a9e21be43d6449c66cc501c6dfb00cf9dae272aff38fe2d0f2e1bb35ca2a9f6ab3e9064499b9e0a4a618e9a4eaa23f624157e8293281a8f66fb8becde635b68453e56e7e79c7e61a5b6468xVXL|-$---://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 rebuild- update to 1.71- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild - Fix documentation (CPAN RT#84318)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Specify all dependencies - Use DESTDIR rather than PERL_INSTALL_ROOT- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- RPM 4.9 dependency filtering added- Perl mass rebuild- Perl mass rebuild- Perl mass rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- 661697 rebuild for fixing problems with vendorach/lib- Mass rebuild with perl-5.12.0- use filtering macros- rebuild against perl 5.10.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for perl 5.10 (again)- rebuild for new perl- bump to 1.66- Update to 1.65.- Update to 1.64.- Excluded the unversioned perl(AppConfig::State) provide.- Update to 1.63. - New upstream maintainer.- Rebuild for FC5 (perl 5.8.8).- Dist tag.- rebuilt- Update to 1.56. - License corrected. - Require perl >= 1:5.6.1 for vendor install dir support. - Moved make test to section %check. - Use pure_install to avoid perllocal.pod workarounds.- First build. 1.711.711.711.711.711.711.711.71-16.el8perl-AppConfigChangesREADMETODOperl-AppConfigLICENSEAppConfig.3pm.gzAppConfig::Args.3pm.gzAppConfig::CGI.3pm.gzAppConfig::File.3pm.gzAppConfig::Getopt.3pm.gzAppConfig::State.3pm.gzAppConfig::Sys.3pm.gzAppConfigAppConfig.pmArgs.pmCGI.pmFile.pmGetopt.pmState.pmSys.pm/usr/share/doc//usr/share/doc/perl-AppConfig//usr/share/licenses//usr/share/licenses/perl-AppConfig//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/AppConfig/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnudirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Perl5 module source text #PRRRRRR R PRRR R PRRR R PRRRR R PRRRR R PRRR R PRRR R https://bugz.fedoraproject.org/perl-AppConfigutf-8c79dde0529170781ede7cc1efc2b12d3b6f35197003e9eacc54d1a7c76106922?0LP]KR!E/֡c)RQ[C b yw >3=Va-qغ/,u.Gp{G @*v+ݙGy4 c'&{c=:;̂` @`lتf[ROzE뻛}&- Ij8匦&<;y+yoz +3@^4 8;cip#XJePh@moU+kOyUñM2Y.y.W=- kzQ)&(h2‰eՁf͌)zSn*́8ޭ?Ub$O-hdfeS@uɗ{d.sKFWQ޵1,?_v"3Qr)R'v$.T~QaandI|F;Rb$8^6rXD#zFqMt0 CAYeQIZ];q^sȞ}o6eFr8HEٟW' +4,X]KR!E/֡x EXL9$)98:4Petr Pisar - 4:5.22.0-353Petr Pisar - 4:5.22.0-352Petr Pisar - 4:5.22.0-351Petr Pisar - 4:5.22.0-350Petr Pisar - 4:5.22.0-349Petr Pisar - 4:5.22.0-348Petr Pisar - 4:5.22.0-347Petr Pisar - 4:5.22.0-346Fedora Release Engineering - 4:5.22.0-345Jitka Plesnikova - 4:5.22.0-244Jitka Plesnikova - 4:5.22.0-243Jitka Plesnikova - 4:5.22.0-242Jitka Plesnikova - 4:5.22.0-241Jitka Plesnikova - 4:5.20.2-328Petr Šabata - 4:5.20.2-327Petr Šabata - 4:5.20.2-326Petr Pisar - 4:5.20.2-325Lubomir Rintel - 4:5.20.2-324Petr Pisar - 4:5.20.2-323Till Maas - 4:5.20.2-322Jitka Plesnikova - 4:5.20.2-321Jitka Plesnikova - 4:5.20.2-320Petr Pisar - 4:5.20.1-319Petr Pisar - 4:5.20.1-318Jitka Plesnikova - 4:5.20.1-317Petr Pisar - 4:5.20.1-316Petr Pisar - 4:5.20.1-315Petr Pisar - 4:5.20.1-314Petr Pisar - 4:5.20.1-313Petr Pisar - 4:5.20.1-312Petr Pisar - 4:5.20.1-311Petr Pisar - 4:5.20.1-310Petr Šabata - 4:5.20.1-309Jitka Plesnikova - 4:5.20.1-308Petr Pisar - 4:5.20.0-307Jitka Plesnikova - 4:5.20.0-306Jitka Plesnikova - 4:5.20.0-305Fedora Release Engineering - 4:5.18.2-304Petr Pisar - 4:5.18.2-303Jitka Plesnikova - 4:5.18.2-302Petr Pisar - 4:5.18.2-301Petr Pisar - 4:5.18.2-300Fedora Release Engineering - 4:5.18.2-299Petr Pisar - 4:5.18.2-298Petr Pisar - 4:5.18.2-297Petr Pisar - 4:5.18.2-296Petr Pisar - 4:5.18.2-295Petr Pisar - 4:5.18.2-294Petr Pisar - 4:5.18.2-293Petr Pisar - 4:5.18.2-292Jitka Plesnikova - 4:5.18.2-291Petr Pisar - 4:5.18.1-290Petr Pisar - 4:5.18.1-289Jitka Plesnikova - 4:5.18.1-288Jitka Plesnikova - 4:5.18.1-287Fedora Release Engineering - 4:5.18.0-286Petr Pisar - 4:5.18.0-285Petr Pisar - 4:5.18.0-284Petr Pisar - 4:5.18.0-283Petr Pisar - 4:5.18.0-282Jitka Plesnikova - 4:5.18.0-281Petr Pisar - 4:5.16.3-280Petr Pisar - 4:5.16.3-279Petr Pisar - 4:5.16.3-278Petr Pisar - 4:5.16.3-277Petr Pisar - 4:5.16.3-276Petr Pisar - 4:5.16.3-275Petr Pisar - 4:5.16.3-274Petr Pisar - 4:5.16.3-273Petr Pisar - 4:5.16.3-272Petr Pisar - 4:5.16.3-271Petr Pisar - 4:5.16.3-270Petr Pisar - 4:5.16.3-269Petr Pisar - 4:5.16.3-268Petr Pisar - 4:5.16.3-267Petr Pisar - 4:5.16.3-266Petr Pisar - 4:5.16.3-265Petr Pisar - 4:5.16.3-264Petr Pisar - 4:5.16.3-263Petr Pisar - 4:5.16.3-262Petr Pisar - 4:5.16.3-261Petr Pisar - 4:5.16.2-260Petr Pisar - 4:5.16x`5X-L0@9 $   rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrcs-5.10.1-12.el8.src.rpmbundled(gnulib)rcsrcs(x86-64)@@@@@@@@@@@@@    @/bin/shdiffutilslibc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.26)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.6)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3h?ggkfU@eeXds@d6@cʂ@ch@ba@a@`@`i@`U__!d^2@]:@\U@[IZ2@Z}@Y@YyXV=@U@UTÉ@T*@S@SP@RRQB@Q@Q]k@Q"@Pe@P OЗOF@On@Nh@MRKKJlE@I2H|@GF@D@DW@C@CCqCJWB%BA@AP@@,@@ ?N>@>.=(=@<<<0;5@:U@9l]9H@86@5N@4L@3ZChristoph Karl - 5.10.1-12Fedora Release Engineering - 5.10.1-11Christoph Karl - 5.10.1-10Fedora Release Engineering - 5.10.1-9Fedora Release Engineering - 5.10.1-8Fedora Release Engineering - 5.10.1-7Fedora Release Engineering - 5.10.1-6Florian Weimer - 5.10.1-5Fedora Release Engineering - 5.10.1-4Christoph Karl - 5.10.1-3Fedora Release Engineering - 5.10.1-2Fedora Release Engineering - 5.10.1-1Fedora Release Engineering - 5.10.0-5Fedora Release Engineering - 5.10.0-4Christoph Karl - 5.10.0-3Fedora Release Engineering - 5.10.0-2Christoph Karl - 5.10.0-1Fedora Release Engineering - 5.9.4-14Fedora Release Engineering - 5.9.4-13Fedora Release Engineering - 5.9.4-12Fedora Release Engineering - 5.9.4-11Fedora Release Engineering - 5.9.4-10Matej Mužila - 5.9.4-9Fedora Release Engineering - 5.9.4-8Fedora Release Engineering - 5.9.4-7Fedora Release Engineering - 5.9.4-6Fedora Release Engineering - 5.9.4-5Fedora Release Engineering - 5.9.4-4Ralf Corsépius - 5.9.4-3Fedora Release Engineering - 5.9.4-2Matej Muzila - 5.9.4-1Matej Muzila - 5.9.3-1Fedora Release Engineering - 5.9.2-4Fedora Release Engineering - 5.9.2-3Honza Horak - 5.9.2-2Honza Horak - 5.9.2-1Fedora Release Engineering - 5.9.0-2Honza Horak - 5.9.0-1Honza Horak - 5.8.2-1Honza Horak - 5.8.1-5Honza Horak - 5.8.1-4Fedora Release Engineering - 5.8.1-3Honza Horak - x8%XLc|+$l|+{+*84630b2b735a6af08920b49ed996eb8c36239801f49e143f751071f8f39c?` Qd~X %D}Rǜٰ<1xR&#M #A5W}5Lٰ<".,𳧑A@-tA^sTZ53JL31Ϸ@5EW%|Z LlW65I2Ъ97HwRI4@VU '^#\T+nŕp?@3Mj`ݛw oAKa;2j?,K8Ft)Z*-Eub dXK0jnP.wN>FC-*rꉂrlx[[P mxzHvMg[:űۗ0Z?n7[bH&XēY!R^q Љ!Fۉ` Qd~ q1f +eԇ%6;vܗ &;'Iڸ؀Bg7+ГBK53rGN=u_*Dq \䳘Dn](6ramjτþgo w FC3:|s>Sa#tsv*;_%AE+Z+ۇkz<:Z,KX?h!|fVdvQRsz3T҂2|QÜBu]+Js}ĭ¡63i]LFk{Zy :Ƨ'k TNQ$*=v]6W|5*AkQvb˕՜*(Y3cb*sEfrO#4D6ޚ= U>O9pq[zc3aae3a07102a1bc25d9258210e6a2d159dd7cadcd990971a43e7fa3876718cd31542e966c47cde83ef7bfa48f0140a941cd2ef4j{yj{xbaa760b8b2b8cc68863fe7a58c92a1790c8-4F(71cd49697470a41dc13d7d89b6e25bb457644dfeU20(721ba1aadbba310c7f978a136daef1629b1127c0y -(7cfb872a393eab4a70a55672239a5be7ef56bde5rp(7424d194700d6022722d62af92d6d560e73b5610 C(724f75d2be012048c512027e24b1c88ba326fe62r (7cf1ddb7bf3540a654723d2ab99fcf876e86f191rt(7d714c6af2d889fa3767a6b449e6e29cc4ada188 o(766a2b84b3b847a70eca1a9f0ff3f7e5634907932o(70abd00510ab2ffa7d892f11ea5d349e31df6b14mc(72caaf2949ffc2cf2d2f55abd12d880f248eac6fjM (7345edae7454355f658e50da4e2b40c13b4e7770tD2(7435db86fb1df286eab78306e8d302b9ef5d1a7eS=-(6e3b9d8325eb126466b9c999b0c114d0a7e04a92n8i(728ab1389020b4bb2f8fde7b6f1fe4cd57cd8b96d0t(7525f7fd5184fcef2db0758d458702a725e3b584o1(753f61fcf95e282ed6bfaceaef825681b273efab7:(740d00f3e65418f5d0e77e6a5711a208e2feaefeab(6e6aab0a6ff9d29aabb636bd4cf3a8085cc4e4e9 -(7359f4105df2c62ce1e3e0e0f3e0d0fee9bcc57e-c(757d62885f7f6397bf9a79ffcd91cdeda7073ca7a;i(75760d3908a8d0579ff06d3cf6560465ad198734e (74b70ef245854e0dfc491571683ce846b905a863gT-(74788baa760b8b2b8cc68863fe7a58c92a1790c8-|1(744d0a6c78f5eceb4a3b34570c4d8b003486d4217p(7424d194700d6022722d62af92d6d560e73b5610 Ue(74212ecbecc854369674323a2d5bb2ae1bef5b07eL-(73a1863ee8772a0be5f978b8d020a562d813d4c4-(l(737f5994dcbd42aaa9e078fbf875e262b0138dd6e (72f7f6a3e4b4e85d298c8375c5a2ebb073b0f08d4Zh(72b4c152b158e79c67b86bfdd59e0b4a845fec37A%d(72960fed5691b09a659eaac3ade4d8f302656fad C(724f75d2be012048c512027e24b1c88ba326fe62rt(724e61eb8ac146ff67a848de9e6e5aa978154bb4o20(721ba1aadbba310c7f978a136daef1629b1127c0y`b(7208bf46931c294e4f54e3adf6611e8dfaa00dc2 8(71ed4d22e8f580772ce5cbdea2c02e19aea3b66054F(71cd49697470a41dc13d7d89b6e25bb457644dfeUe(71bd4723f36bdcd4c5fed23f9f03681be830a8b43 (7182c8e284fab0f7c9b8d888551ad54bdfdda6b9ra(713f859fa68c48c2b48f6b9cc7f618236255f173b(71216574abc9e1da1e750e4e7cde3df5a4b499d95o(70abd00510ab2ffa7d892f11ea5d349e31df6b14mw:(706251cec14b43c019d76612af36c1912383a4daaQn(6fdf7b4619f1c4dc559c9ee9b1aed5d667a59bbd-a(6fde617f041430a67b11a5b44a7c440afe407812s"(6fcb21259dc2c48668caee97ba81e5c4b72409f6i(6fc31e26e197fd5224995c96563fe2d96620635fge(6f43e6f84d9cb0d468e858930ccbbdde06f265aevF(6ee859d97d4329c7d94b5bb197d1c7fb265f707esd(6e746c4b424bcb0162ac18a43f681965d11a4d19.>(6e5f87ac0ec08dc2f1953bc9c3b5fcdf9f0c56d5(6e13a63d65554862acc6e9a84dfa41caa1e37e2ba(6dee509c61c5fb10c62029e3728df3b5220209389xXLa+[H$K[H ??d"& 2 04 9EZ`hl n p t  `   (89 :GHIXY\]^bdoetfwlytuv ,UghCcpanel-perl-542-cpanel-syncutil0.81.cp130~el8CPAN module - Perl extension for creating utilities that work with cpanelsync aware directoriesCpanel build perl module 'cPanel::SyncUtil'Perl extension for creating utilities that work with cpanelsync aware directoriesh&bh-centos-8.dev.cpanel.net[)perlcpanel/perlhttps://metacpan.orglinuxnoarch[)$U1bbdd79f6710a11572cd8ba156850fd8f0f887b536f60c59fd6ebddf8b6c314ferootrootcpanel-perl-542-cpanel-syncutil-0.8-1.cp130~el8.src.rpmcpanel-perl(cPanel::SyncUtil)cpanel-perl-542-cpanel-syncutilcpanel-perl-cpanel-syncutil     cpanel-perl-542cpanel-perl-542-archive-tarcpanel-perl-542-digest-md5-filecpanel-perl-542-digest-shacpanel-perl-542-file-findcpanel-perl-542-file-slurpcpanel-perl-542-getopt-stdrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@UQ+R@Busy Camels - 0.8-1.cp130Busy Camels - 0.8-1.cp108Busy Camels - 0.8-1.cp1198Todd Rinaldo - 0.8-1.cp1146Todd Rinaldo - 0.7-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: cPanel-SyncUtil 0.8- Update from upstream: cPanel-SyncUtil 0.70.80.8-1.cp130~el80.8SyncUtil.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/cPanel/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8203d3d8d7edd17ef5e69199c150b169633311e23fef9a55528266ce9c7de0fcd?%L|쐶H~B:88a4ef430d0f040208bc010e1c004b622d5e71bc52e434d7bff1d86508aad53c3ef9a8f9a5ca648428ec2dac2e7b63abb74a469aj{\\j{Ucpanel-perl(Regexp::Parser::anyof_range)cYU(cpanel-perl(Regexp::Parser::anyof_close):Y4(cpanel-perl(Regexp::Parser::anyof_class)eYe'cpanel-perl(Regexp::Parser::anyof_char)peYe"cpanel-perl(Regexp::Parser::anyof)I::Yn#cpanel-perl(Regexp::Parser::anchor)OSY"cpanel-perl(Regexp::Parser::alnum)4Yc'cpanel-perl(Regexp::Parser::__object__)cYUcpanel-perl(Regexp::Parser)ccpanel-perl(Ref::Util::XS)cpanel-perl(Ref::Util::PP)rpgcpanel-perl(Ref::Util)Havcpanel-perl(Readonly::XS)cpanel-perl(Readonly::Scalar)cpanel-perl(Readonly::Hash)cpanel-perl(Readonly::Array)cpanel-perl(Readonly)xhXLXi-$--H-?(d  I(,;J[ jv * T  = T  z     ( 8 $09 0:0G!$H!xI!X!Y"\"4]"^#b$id%e%f%l%t%u&0v&w'x'dy'((X(\(((((+ + -,-U---g-h-Cperl-AppConfig1.7116.el8Perl module for reading configuration filesAppConfig has a powerful but easy to use module for parsing configuration files. It also has a simple and efficient module for parsing command line arguments. For fully-featured command line parsing, a module is provided for interfacing AppConfig to Johan Vromans' extensive Getopt::Long module. Johan will continue to develop the functionality of this package and its features will automatically become available through AppConfig.]HTbuildvm-15.phx2.fedoraproject.orgxFedora ProjectFedora ProjectGPL+ or ArtisticFedora ProjectUnspecifiedhttps://metacpan.org/release/AppConfiglinuxnoarchl*N* H(f -p&~^ 3 )A큤A큤A큤]HTTTzTP]HTTP]HS]HS]HS]HS]HS]HS]HS]HSTpTTTTT T2e02a612c82316e12a10563b72d548dc04dc9012e8b3400eec1c28e546a41adcb299d3307d2ce428d0b008e365a055d897124b664c26451c9a07de79896b3a5f98fa6041f72cf8d9234e440c85815f0e289ee55ab3e1db5f24f446d0a14558e80b22dd532e4123a511d14989c4169ed56b7316cf844c29c7897a1638a4616868874d9f1e368f381ce38f84efe54c8cb71ace1232d147af7bcf1fc0c8823770d9a7ac1b2354128e4624264e3646342dbe5b8cd6bb3606461dec0326e8eda9bdf4083d8158a3bf4a1bfc8e9d201823783541f292cbeb35f82f856167c72784b8152fc50d4ccebc666fe0d5b90b258acdbecf85d9141879a32ec545f2c7bcca9ce0c011489711d1fc4ff124e93cb664cb8fa1a5e5035d0f41b02ccc8165f8c41127cd08e27dfc1add4e28b877748c6f6e6e569adcbccd644224e66e4292a8a6d06b785b65aa63c4135f57503455a5860b83344359eb1a7ea298b6fbd2c45bec9f81ba47e51a0e7aab5565b3e05ae70c56980fefa9c4eed503bedc9b0e4c48bb4226c04389817cf090225554555a5a5cb5e7b5e0e9c894aa972c3180aed5ea88ab220e49ddf6754a658a81b7c04a0aac05471d1dea34875b7704b5f59a4f3dc41d214a98d69ff1bcc78e5a900cce215442fd3b40339a6f07ff8919eac76a28e8610248540f928f45ac7ee61f1979e1320f5bb8cb441ebffe5b6189a5bb9632984b30ec7b28b1eb4a153f494854a582b89660e40aff43386684de687f19000bca38f5b1e6093d0d79de2f0e707d71a5a85d4175e5e29b1a66e6b5ff1650fadbf82ee1rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-AppConfig-1.71-16.el8.src.rpmperl(AppConfig)perl(AppConfig::Args)perl(AppConfig::CGI)perl(AppConfig::File)perl(AppConfig::Getopt)perl(AppConfig::State)perl(AppConfig::Sys)perl-AppConfig@ @@@@ @@@@@    perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(AppConfig)perl(AppConfig::State)perl(Exporter)perl(Getopt::Long)perl(POSIX)perl(base)xXGLT$#TTTg or removing entries for ipsets from files - Support icmp-type usage in rich rules - Support for more icmp types - Support for h323 conntrack helper - New services - Code cleanup and several other bug fixes - Translation updates- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuild for Python 3.6- Dropping firewalld-selinux package again as the required fix made it into selinux-policy packages for F-23+, updated selinux-policy version conflicts- New firewalld-selinux sub package delivering the SELinux policy module for firewalld (RHBZ#1396765) (RHBZ#1394625) (RHBZ#1394578) (RHBZ#1394573) (RHBZ#1394569) - New firewalld release 0.4.4.2: - firewalld.spec: Added helpers and ipsets paths to firewalld-filesystem - firewall.core.fw_nm: create NMClient lazily - Do not use hard-coded path for modinfo, use autofoo to detect it - firewall.core.io.ifcfg: Dropped invalid option warning with bad format string - firewall.core.io.ifcfg: Properly handle quoted ifcfg values - firewall.core.fw_zone: Do not reset ZONE with ifdown - Updated translations from zanata - firewall-config: Extra grid at bottom to visualize firewalld settings- firewall-config: Use proper source check in sourceDialog (fixes issue#162) - firewallctl: New support for helpers - Translation updates- Fix dist-check - src/Makefile.am: Install new helper files - config/Makefile.am: Install helpers - Merged translations - Updated translations from zanata - firewalld.spec: Adapt requires for PyQt5 - firewall-applet: Fix fromUTF8 for python2 PyQt5 usage - firewall-applet: Use PyQt5 - firewall-config: New nf_conntrack_select dialog, use nf_conntrack_helpers D-Bus property - shell-completion/bash/firewall-cmd: Updates for helpers and also some fixes - src/tests/firewall-[offline-]cmd_test.sh: New helper tests, adapted module tests for services - doc/xml/seealso.xml: Add firewalld.helper(5) man page - doc/xml/seealso.xml: Add firewalld.ipset(5) man page - Fixed typo in firewalld.ipset(5) man page - Updated firewalld.dbus(5) man page - New firewalld.helper(5) man page - doc/xml/firewall-offline-cmd.xml: Updated firewall-offline-cmd man page - doc/xml/firewall-cmd.xml: Updated firewall-cmd man page - firewall-offline-cmd: New support for helpers - firewall-cmd: New support for helpers - firewall.command: New check_helper_family, check_module and print_helper_info methods - firewall.core.fw_test: Add helpers also to offline backend - firewall.server.config: New AutomaticHelpers property (rw) - firewall.server.config: Fix an dict size changed error for firewall.conf file changes - firewall.server.config: Make LogDenied property readwrite to be consistent - Some renames of nf_conntrack_helper* functions and structures, helpers is a dict - firewall.core.fw: Properly check helper setting in set_automatic_helpers - firewall.errors: Add missing BUILTIN_HELPER error code - No extra interface for helpers needed in runtime, dropped DBUS_INTERFACE_HELPER - firewall.server.firewalld: Drop unused queryHelper D-Bus method - New helpers Q.931 and RAS from nf_conntrack_h323 - firewall.core.io.helper: Allow dots in helper names, remove underscore - firewall.core.io.firewalld_conf: Fixed typo in FALLBACK_AUTOMATIC_HELPERS - firewall-[offline-]cmd: Use sys.excepthook to force exception_handler usage always - firewall.core.fw_config: new_X methods should also check builtins - firewall.client: Set helper family to "" if None - firewall.client: Add missing module string to FirewallClientHelperSettings.settings - config/firewalld.conf: Add possible values description for AutomaticHelpers - helpers/amanda.xml: Fix typo in helper module - firewall-config: Added support for helper module setting - firewall.client: Added support for helper module setting - firewall.server.config_helper: Added support for helper module setting - firewall.core.io.service, firewall.server.config_service: Only replace underscore by dash if module start with nf_conntrack_ - firewall.core.fw_zone: Use helper module instead of a generated name from hexXLz$~f;42b83343f970e8ede0bc44faa5ba8f1040f2040a684f0d0a46824e6f2f40f08662d04776ee3189c80d37c99927214bde44b6f40a506badf50366f8b3805b22ac4122a6c11874c8a90195cdbdfea15a0d46359a0a684f0d0a46824e6f2f40f08662d04776ee3189c80d37c99927214bde44b6f4f08571173c9ddff180e6bc2cc30953888a991cf92c142fed53f00e6e8033c812f08571173c9ddff180e6bc2cc30953888a991cf92c142fed53f00e6e8033c812f08571173c9ddff180e6bc2cc30953888a991cf92c142fed53f00e6e8033c8120bfc6733c5f2efc9332910e556901c005fa2ccb8695ea809a907d48c865f06c50bfc6733c5f2efc9332910e556901c005fa2ccb8695ea809a907d48c865f06c50bfc6733c5f2efc9332910e556901c005fa2ccb8695ea809a907d48c865f06c51b1bd1d6e143826e6413224baf422ed59485e99c5875f0c35babd614891708861b1bd1d6e143826e6413224baf422ed59485e99c5875f0c35babd614891708861b1bd1d6e143826e6413224baf422ed59485e99c5875f0c35babd61489170886ebe955eb8af928521b6bf9c758ae441681f1349f61b6b26aea2af2c4c9ab9dbf9ae9e204bfe720ac32ff60576299c7be3b06f1de18d198d4d8d1fad049ff6490ebe955eb8af928521b6bf9c758ae441681f1349f61b6b26aea2af2c4c9ab9dbf73a734ab1683ba46c41153a309917ea0d934ee7162823cc009335bc718cd27ac06b961d30ceefcdea8e9bc42639c8cb702746ff4900883daec9628135afe164b73a734ab1683ba46c41153a309917ea0d934ee7162823cc009335bc718cd27acea0ecf264d2a573413c2a0f64ae9a0c63fb1683773bd917c979d630c5c0e85951cde49f1982673e329dbe6c15625efcbc7e981e54bfdb3c296eaa609f1f2f363ea0ecf264d2a573413c2a0f64ae9a0c63fb1683773bd917c979d630c5c0e859575a54dbcc899cb758c92b884c80852da2dbb4dc055c69e28028680720313441cd2fc4f600f0d9953c4272e0ca263955e791b38d4795619986cc8c332b577b74875a54dbcc899cb758c92b884c80852da2dbb4dc055c69e28028680720313441c3cbc9479f2c4d187b470a0b17d8240e6970fb9b51df7a509c23eafec903d76f5a5e541e2c382010d7e1920befae7e030524c69c53e1d94fcc7690677078a42b33cbc9479f2c4d187b470a0b17d8240e6970fb9b51df7a509c23eafec903d76f595a72f2ed96040d963a7fd787fe5ecb0a848b9e8923c17715e450dd1ee156ef8e3dcef79e1d673e3cc0d9626007f5c4ac84dc9f954e489f96a76fcd85304f98595a72f2ed96040d963a7fd787fe5ecb0a848b9e8923c17715e450dd1ee156ef8f5fd06e67ff56e0a2c963a8c2f8c3c3d170925fac2426c05a3769d79b62587d3c9e8b75e0152585a33ce0b1bc255f730330ce4af35983e3217479e76f413663ff5fd06e67ff56e0a2c963a8c2f8c3c3d170925fac2426c05a3769d79b62587d3301385d9497b81f2fe3ba3231765ed8b51a8ea77556943836e9a544b97ab2101feedd8c310bad6266d99a71b28b55b68758830da4b8a2339bcff78c066e5c5ae301385d9497b81f2fe3ba3231765ed8b51a8ea77556943836e9a544b97ab21011224241dcfb4ec6aff3cafc66adeb2b2a3759397a28693173915458c50040143e683ab0ee9404baec656a88d637910bcb2badb4b4e5d5def2b80cc4534551e6fc01314dc51d1c8effeba2528720a65da133596d4143200c68595c02067bf1da24f8201d3ada7b6d0f450b417e55747adaee5f894412c4875169b0736a5ff0faa542b804b243b502b5525a8b1f04a02a120b1db4e3599f5c7865e60693ed3672ad75c1eb4131db658b8622acffd8262ecbd7337425c799ea3be8d605ea6be7b94a73482badacc4a69ff7fae9445793a4d858212fdef103360a478bbfd6ed2f496cdbf655c66778a19f0e25754a5f198a850c8bd958ce651e8fe4b2b52ad7f9c63c7cc050ec9cc3cc6a47215b5bc79b2d3e5c6ed895a4300ab0e20f6c249385e3f984eb0bb02ebdf76da3cadde9f54587204f819723346a576176410b86141d15b5d7a11093a1f6510de786b0e9d67902ab33a57f637cd8f5e2603cf6c5c609a186c13af04d672c71abc82181961a7f7bce7b9ea79becdae37f55c78001053ce875e0e21a736c0d20fc49df5f08a69f544e54efa5d9516e1b73d3bfb50da1c63235f465277c96c107a5af544b0a962561f97cb0bfd75906d9bf9741450ed02b0e112a367662dbb439a495f9ec81c86854d108d3a0b1c5c0b06c942fc940b357e0cd3fbe62477a977a649c6bf04f6b0b8304f0b365d0d447700968faae19c69259dc114b42c4d1597f9a2c901b0534ba7c92f62c62d16d57773f6a5ee16ab899903d3fbe62477a977a649c6bf04f6b0b8304f0b365d0d447700968faae19c69259df603b4a051c2c78c73ec44ead2b4b73f6584f909f3099b8b91ec21cec53ae3deec34235e6540adb4295ee0dabc784508dcf7f94b9dc859f8c9db6b0169b1f75bf603b4a051c2c78c73ec44ead2b4b73f6584f909f3099b8b91ec21cec53ae3de8d1a5b958dade2819e16c47e037f90486078040c828bb9a01f1892308df089ca09e10837de00c46ec922b137c082e52de95cc338139eca0388e93cd28f1139f08d1a5b958dade2819e16c47e037f90486078040c828bb9a01f1892308df089ca3f1fd852597e60ff37af09e473608f3b8fcc3d45f2253461af50bfc0176390333f1fd852597e60ff37af09e473608f3b8fcc3d45f2253461af50bfc017639033xX\L(C*$u***senkraenzer 2.5.1-1Bernhard Rosenkraenzer 2.5-1Bernhard Rosenkraenzer 2.5-0.g.1Tim Powers Bernhard Rosenkraenzer 2.5-0.f.4Bernhard Rosenkraenzer 2.5-0.f.3Bernhard Rosenkraenzer 2.5-0.f.2Bernhard Rosenkraenzer 2.5-0.f.1Bernhard Rosenkraenzer 2.4.2-7Bernhard Rosenkraenzer 2.5e-4Bernhard Rosenkraenzer 2.5e-3Bernhard Rosenkraenzer 2.5e-2Bernhard Rosenkraenzer 2.5e-1Trond Eivind Glomsrød Jakub Jelinek Prospector Bernhard Rosenkraenzer Florian La Roche Bernhard Rosenkraenzer Cristian Gafton Jeff Johnson Bill Nottingham Cristian Gafton Preston Brown Preston Brown Prospector System Cristian Gafton Donnie Barnes Erik Troan - Fixed FTBFS with glibc-2.28 Resolves: rhbz#1611721- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Moved binaries to /usr/bin Resolves: rhbz#1540485- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- New version Related: rhbz#1421129 - Updated patches- New version Resolves: rhbz#1421129- New version Resolves: rhbz#1419921 - De-fuzzified patches- New version Resolves: rhbz#1402379 - De-fuzzified patches- Re-enabled 'make check', glibc seems fixed- New version Resolves: rhbz#1381203 - Disabled 'make check' due to glibc bug rhbz#1381582- New version Resolves: rhbz#1329627 - De-fuzzified patches- New version Resolves: rhbz#1316890- New version Resolves: rhbz#1305035 - Dropped disable-performance-related-tests, better-encoding-errors-handling, Pc-consistent-results, and test-pcre-count-fix patches (all upstreamed) - De-fuzzified man-fx-gs, and help-align patches- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Fixed pcre-count test on secondary architectures (byt test-pcre-count-fix patch) Resolves: rhbz#1296842- Used latest upstream patch for bug 1269014 to fix regression, fixed order of patches Resolves: rhbz#1269014- Improved encoding errors handling (by better-encoding-errors-handling patch) Resolves: rhbz#1219141 - kwset-abuse test no longer needs to be explicitly set executable- Fixed grep to be consistent in 'grep -Pc' and 'grep -P | wc -l' Resolves: rhbz#1269014- Disabled performance related tests (by disable-performance-related-tests patch), patch backported from upstream - Dropped disable-long-pattern-perf-test patch (not needed, covered by previous patch) Resolves: rhbz#1278428- New version Resolves: rhbz#1277113 - Dropped buf-overrun-fix, recurse-behaviour-change-doc, gnulib patches (all upstreamed) - Minor spec cleanup to be consistent with whitespaces- Minor spec cleanups and modifications - Drop Changelog, details in NEWS - Add gnulib patch to fix FTBFS with perl 5.22- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Documented change in behaviour of recurse option Resolves: rhbz#1178305- Rebuilt for Fedora 23 Change https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Fixed buffer overrun for grep -F Resolves: rhbz#1183653- Disable silent rules to make the build process more verbose- New version Resolves: rhbz#1167657 - De-fuzzified patches - Dropped pcre-backported-fixes patch (not needed)- Backported more PCRE fixes (by pcre-backported-fixes patch) - Dropped pcre-invalid-utf8-fix patch, handled by pcre-backported-fixes patch- Fixed invalid UTF-8 byte sequence error in PCRE mode (by pcre-invalid-utf8-fix patch) Resolves: rhbz#1161832- Added script to chxXNL"@[T$*TTTFirewallClientZoneSettings: Set proper default target - if Python2 then encode strings from sax parser (RHBZ#1059104, RHBZ#1058853) - firewall-cmd: - don't colour output of query commands (RHBZ#1097841) - use "default" instead of {chain}_{zone} (RHBZ#1075675) - New --get-target and --set-target - Create and remove permanent zones, services and icmptypes - firewall-config: - Adding services and icmptypes resulted in duplicates in UI - Use left button menu of -applet in Option menu - firewall-offline-cmd: same functionality as 'firewall-cmd --permanent' - firewall-applet: ZoneConnectionEditor was missing the Default Zone entry - bash-completion: getting zones/services/icmps is different with/without --permanent - firewalld.zone(5): removed superfluous slash (RHBZ#1091575) - updated translations- Fixed persistent port forwarding (RHBZ#1056154) - Stop default zone rules being applied to all zones (RHBZ#1057875) - Enforce trust, block and drop zones in the filter table only (RHBZ#1055190) - Allow RAs prior to applying IPv6_rpfilter (RHBZ#1058505) - Fix writing of rule.audit in zone_writer()- fix regression introduced in 0.3.9 (RHBZ#1053932)- fix regressions introduced in 0.3.9 (RHBZ#1054068, RHBZ#1054120)- translation updates - New IPv6_rpfilter setting to enable source address validation (RHBZ#847707) - Do not mix original and customized zones in case of target changes, apply only used zones - firewall-cmd: fix --*_lockdown_whitelist_uid to work with uid 0 - Don't show main window maximized. (RHBZ#1046811) - Use rmmod instead of 'modprobe -r' (RHBZ#1031102) - Deprecate 'enabled' attribute of 'masquerade' element - firewall-config: new zone was added twice to the list - firewalld.dbus(5) - Enable python shebang fix again - firewall/client: handle_exceptions: Use loop in decorator - firewall-offline-cmd: Do not mask firewalld service with disabled option - firewall-config: richRuleDialogActionRejectType Entry -> ComboBox - Rich_Rule: fix parsing of reject element (RHBZ#1027373) - Show combined zones in permanent configuration (RHBZ#1002016) - firewall-cmd(1): document exit code 2 and colored output (RHBZ#1028507) - firewall-config: fix RHBZ#1028853- fix memory leaks - New option --debug-gc - Python3 compatibility - Better non-ascii support - several firewall-config & firewall-applet fixes - New --remove-rules commands for firewall-cmd and removeRules methods for D-Bus - Fixed FirewallDirect.get_rules to return proper list - Fixed LastUpdatedOrderedDict.keys() - Enable rich rule usage in trusted zone (RHBZ#994144) - New error codes: INVALID_CONTEXT, INVALID_COMMAND, INVALID_USER and INVALID_UID- Don't fail on missing ip[6]tables/ebtables table. (RHBZ#967376) - bash-completion: --permanent --direct options - firewall/core/fw.py: fix checking for iptables & ip6tables (RHBZ#1017087) - firewall-cmd: use client's exception_handler instead of catching exceptions ourselves - FirewallClientZoneSettings: fix {add|remove|query}RichRule() - Extend amanda-client service with 10080/tcp (RHBZ#1016867) - Simplify Rich_Rule()_lexer() by using functions.splitArgs() - Fix encoding problems in exception handling (RHBZ#1015941)- firewall-offline-cmd: --forward-port 'toaddr' is optional (RHBZ#1014958) - firewall-cmd: fix variable name (RHBZ#1015011)- remove superfluous po files from archive- firewalld.richlanguage.xml: correct log levels (RHBZ#993740) - firewall-config: Make sure that all zone settings are updated properly on firewalld restart - Rich_Limit: Allow long representation for duration (RHBZ#994103 - firewall-config: Show "Changes applied." after changes (RHBZ#993643) - Use own connection dialog to change zones for NM connections - Rename service cluster-suite to high-availability (RHBZ#885257) - Permanent direct support for firewall-config and firewall-cmd - Try to avoid file descriptor leaking (RHBZ#951900) - New functions to split and join args properly (honoring quotes) - firewall-cmd(1): 2 simple examples - Better IPv6 NAT checking. - Ship firewalld.direct(5).- Only use one PK action xXL(l=$ =K1.el8_103.0.4-14.6.0-14.0.4-14.0-15.2-14.14.3j}jPi@i@iq@i@ij(@h@hh@5@ga@g@gNf@fyfaf>@f@f~fh<@f4f4f4f4eBee@e@Karolina Surma - 3.12.14-1Lukáš Zachar - 3.12.13-3Charalampos Stratakis - 3.12.13-2Tomáš Hrnčiar - 3.12.13-1Tomáš Hrnčiar - 3.12.12-4Tomáš Hrnčiar - 3.12.12-3Lumír Balhar - 3.12.12-2Karolina Surma - 3.12.12-1Lumír Balhar - 3.12.11-2Tomáš Hrnčiar - 3.12.11-1Miro Hrončok - 3.12.10-1Charalampos Stratakis - 3.12.9-1Charalampos Stratakis - 3.12.8-1Tomáš Hrnčiar - 3.12.6-1Charalampos Stratakis - 3.12.5-2Tomáš Hrnčiar - 3.12.5-1Charalampos Stratakis - 3.12.4-3Charalampos Stratakis - 3.12.4-2Tomáš Hrnčiar - 3.12.4-1Charalampos Stratakis - 3.12.3-2Lumír Balhar - 3.12.3-1Lumír Balhar - 3.12.2-3Lumír Balhar - 3.12.2-2Lumír Balhar - 3.12.2-1Charalampos Stratakis - 3.12.1-4Charalampos Stratakis - 3.12.1-3Charalampos Stratakis - 3.12.1-2Tomáš Hrnčiar - 3.12.1-1- Update to Python 3.12.14 Resolves: RHEL-227198- Security fix for CVE-2026-15308 Resolves: RHEL-193776- Security fixes for CVE-2026-1502, CVE-2026-4786, CVE-2026-6100, CVE-2026-2297, CVE-2026-3644, CVE-2026-4224 Resolves: RHEL-168130, RHEL-167892- Update to 3.12.13 - Security fixes for CVE-2025-6075, CVE-2025-13837, CVE-2025-15282, CVE-2025-59375, CVE-2026-0672 Related: RHEL-168130, RHEL-167892- Security fix for CVE-2026-4519 Resolves: RHEL-158029- Security fixes for CVE-2026-0865, CVE-2025-15366, CVE-2025-15367 and CVE-2026-1299 Resolves: RHEL-143065 Resolves: RHEL-143122 Resolves: RHEL-144862- Security fix for CVE-2025-13836 Resolves: RHEL-140993- Update to 3.12.12 - Security fix for CVE-2025-8291 and CVE-2025-12084 Resolves: RHEL-128364, RHEL-135391- Security fix for CVE-2025-8194 Resolves: RHEL-106343- Update to 3.12.11 - Security fixes for CVE-2025-4517, CVE-2025-4330, CVE-2025-4138, CVE-2024-12718, CVE-2025-4435 Resolves: RHEL-98040, RHEL-98010, RHEL-97808, RHEL-98070, RHEL-98213- Update to 3.12.10 Resolves: RHEL-86888- Update to 3.12.9 - Security fix for CVE-2025-0938 Related: RHEL-86888- Update to 3.12.8 - Security fix for CVE-2024-9287 and CVE-2024-12254 Resolves: RHEL-64880, RHEL-70315- Update to 3.12.6 Resolves: RHEL-57405- Security fix for CVE-2024-8088 Resolves: RHEL-55939- Update to 3.12.5 - Security fix for CVE-2024-6923 Resolves: RHEL-53075- Properly propagate the optimization flags to C extensions- Build Python with -O3 - https://fedoraproject.org/wiki/Changes/Python_built_with_gcc_O3- Update to 3.12.4 Resolves: RHEL-44074- Enable importing of hash-based .pyc files under FIPS mode Resolves: RHEL-40776- Update to 3.12.3 Related: RHEL-33685- Move all test modules to the python3-test package, namely: - __phello__ - _xxsubinterpreters - xxlimited - xxlimited_35 - xxsubtype- Fix tests for XMLPullParser with Expat with fixed CVE- Update to 3.12.2 Resolves: RHEL-33685- Add Red Hat configuration for CVE-2007-4559- Support OpenSSL FIPS mode - Disable the builtin hashlib hashes except blake2- Disable bootstrap- Initial package - Fedora contributions by: Björn Esser Bohuslav Kabrda Charalampos Stratakis Dan Horák David Malcolm Dennis Gilmore Florian Weimer Gwyn Ciesla xXLP$untu- EA-12428: Update ea-php81 from v8.1.29 to v8.1.30 - Fixed bug GHSA-865w-9rf3-2wh5 (Logs from childrens may be altered). (CVE-2024-9026) - Fixed bug GHSA-9pqp-7h25-4f32 (Erroneous parsing of multipart form data). (CVE-2024-8925) - Fixed bug GHSA-p99j-rfp4-xqvq (Bypass of CVE-2024-4577, Parameter Injection Vulnerability). (CVE-2024-8926) - Fixed bug GHSA-94p6-54jq-9mwp (cgi.force_redirect configuration is bypassable due to the environment variable collision). (CVE-2024-8927)- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-12192: Update ea-php81 from v8.1.28 to v8.1.29 - Fixed bug GHSA-3qgc-jrrr-25jv (Bypass of CVE-2012-1823, Argument Injection in PHP-CGI). (CVE-2024-4577) - Fixed bug GHSA-w8qr-v226-r27w (Filter bypass in filter_var FILTER_VALIDATE_URL). (CVE-2024-5458) - Fixed bug GHSA-9fcc-425m-g385 (Bypass of CVE-2024-1874). (CVE-2024-5585) - The openssl_private_decrypt function in PHP, when using PKCS1 padding (OPENSSL_PKCS1_PADDING, which is the default), is vulnerable to the Marvin Attack- ZC-11730: Add GD support for AVIF format on Ubuntu 22 and higher- EA-12087: Update ea-php81 from v8.1.27 to v8.1.28 - Fixed bug GHSA-pc52-254m-w9w7 (Command injection via array-ish $command parameter of proc_open). (CVE-2024-1874) - Fixed bug GHSA-wpj3-hf5j-x4v4 (__Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix). (CVE-2024-2756) - Fixed bug GHSA-h746-cjrr-wfmr (password_verify can erroneously return true, opening ATO risk). (CVE-2024-3096)- ZC-11561: Add GD support for AVIF format on RHEL 8 and newer (RHEL only)- EA-11892: Update ea-php81 from v8.1.26 to v8.1.27- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: Correct Ubuntu build issues- EA-11824: Update ea-php81 from v8.1.25 to v8.1.26- EA-11776: Update ea-php81 from v8.1.24 to v8.1.25- EA-11716: Update ea-php81 from v8.1.23 to v8.1.24- EA-11664: Update ea-php81 from v8.1.22 to v8.1.23- EA-11589: Update ea-php81 from v8.1.21 to v8.1.22 - Libxml: Fixed bug GHSA-3qrf-m4j2-pcrr (Security issue with external entity loading in XML without enabling it). (CVE-2023-3823) - Phar: Fixed bug GHSA-jqcx-ccgc-xwhv (Buffer mismanagement in phar_dir_read()). (CVE-2023-3824)- EA-11538: Update ea-php81 from v8.1.20 to v8.1.21- EA-11477: Update ea-php81 from v8.1.19 to v8.1.20 - Fixed bug GHSA-76gg-c692-v2mw - (Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP).- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Statically link ea-libc-client- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- EA-11415: Update ea-php81 from v8.1.18 to v8.1.19- ZC-10873: Simplify the libidn deps, for building on Ubuntu 20 and 22- EA-11356: Update ea-php81 from v8.1.17 to v8.1.18- EA-11300: Update ea-php81 from v8.1.16 to v8.1.17- EA-11244: Update ea-php81 from v8.1.15 to v8.1.16 - Fixed bug #81744 (Password_verify() always return true with some hash). (CVE-2023-0567) - Fixed bug #81746 (1-byte array overrun in common path resolve code). (CVE-2023-0568) - Fixed bug GHSA-54hq-v5wp-fqgv (DOS vulnerability when parsing multipart request body). (CVE-2023-0662)- EA-11208: Update ea-php81 from v8.1.14 to v8.1.15- EA-11075: Correct default value description for log_errors in php.ini- EA-11133: Update ea-php81 from v8.1.13 to v8.1.14 - PDO::quote() may return unquoted string). (CVE-2022-31631)- EA-11070: Update ea-php81 from v8.1.12 to v8.1.13- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11021: Update ea-php81 from v8.1.11 to v8.1.12 - GD: OOB read due to insufficient input validation in imageloadfont(). (CVE-2022-31630) - Hash: buffer overflow in hash_update() on long parameter. (CVE-2022-37454)- EA-10958: Update ea-php81 from v8.1.10 to v8.1.11- ZC-10009: Add changes so that it builds on AlmaLinux 9- ZC-10260: Link deb against libcurl 4 explicitly- EA-109xpX- LG$a T \V /эh^5xXOLXs>$ >>>TpzTl@T`TO@TN3T&T @T @SS@S@S0S@SSSSS@S\SSDSP@SS @S@SSSSwO@SnShSg}@Sg}@Sg}@S`SRe@SRe@SM@S2@S,)S)S L@SSS S@R@Ry@R@R3@R3@R۾@Koichiro Iwao - 23.1.4-4.alma.1Dave Airlie - 23.1.4-4José Expósito - 23.1.4-3José Expósito - 23.1.4-2Dave Airlie - 23.1.4-1Dave Airlie - 23.1.0-1Dave Airlie - 22.3.0-2Dave Airlie - 22.3.0-1Dave Airlie - 22.3.0-0.4Dave Airlie - 22.3.0-0.3Dave Airlie - 22.3.0-0.2Dave Airlie - 22.3.0-0.1Dave Airlie - 22.1.5-1Dave Airlie - 22.1.1-1Dave Airlie - 21.3.4-1Dave Airlie - 21.3.0-1Dave Airlie - 21.1.5-1Dave Airlie - 21.1.3-1Dave Airlie - 21.1.1-2Dave Airlie - 21.1.1-1Dave Airlie - 20.3.3-1Dave Airlie - 20.3.2-1Dave Airlie - 20.3.1-1Dave Airlie - 20.3.0-2Dave Airlie - 20.3.0-1Dave Airlie - 20.3.0-0.1.rc2Dave Airlie - 20.1.4-1Dave Airlie - 20.1.2-3Dave Airlie - 20.1.2-2Dave Airlie - 20.1.2-1Dave Airlie - 20.1.1-1Dave Airlie - 20.1.0-1Dave Airlie - 20.1.0-0.1.rc4Dave Airlie - 19.3.4-2Dave Airlie - 19.3.4-1Dave Airlie - 19.3.3-1Dave Airlie - 19.3.0-3Dave Airlie - 19.3.0-2Dave Airlie - 19.3.0-1Dave Airlie - 19.1.4-2Dave Airlie - 19.1.4-1Dave Airlie - 19.1.0-0.5Dave Airlie - 19.1.0-0.4Dave Airlie - 19.1.0-0.3Dave Airlie - 19.1.0-0.2Dave Airlie - 19.1.0-0.1Dave Airlie - 18.3.1-5Dave Airlie - 18.3.1-4Dave Airlie - 18.3.1-3Dave Airlie - 18.3.1-2Dave Airlie - 18.3.1-1Tom Stellard Adam Jackson - 18.3.0-0.2Adam Jackson - 18.2.2-1Adam Jackson - 18.2.1-1Adam Jackson - 18.2.0-2Dave Airlie - 18.2.0-1Ray Strode - 18.1.3-4Tom Stellard - 18.1.3-3Dave Airlie - 18.1.3-2Adam Jackson - 18.1.3-1Adam Jackson - 18.1.2-2Adam Jackson - 18.1.2-1Adam Jackson - 18.0.5-1Adam Jackson - 18.0.3-1Dave Airlie - 18.0.2-2Adam Jackson - 18.0.2-1Tom Stellard - 17.3.6-2Adam Jackson - 17.3.6-1Igor Gnatenko - 17.3.5-2Igor Gnatenko - 17.3.5-1Igor Gnatenko - 17.3.4-1Peter Robinson 17.3.3-1Igor Gnatenko - 17.3.1-1Igor Gnatenko - 17.3.0-0.4.rc3Peter Robinson 17.3.0-0.3.rc3Peter Robinson 17.3.0-0.1.rc2Peter Robinson 17.2.4-1Tom Stellard - 17.2.3-2Gwyn Ciesla - 17.2.3-1Peter Robinson - 17.2.2-4Dave Airlie - 17.2.2-3Adam Jackson - 17.2.2-2Peter Robinson O ^j" " d" " 0"  "  @" " r"  8"  ,(*84Q9xQ:!QG1"H2,"I2"X2Y2\3"]3"^4 b5d7e7f7l7t78"u7"v8H w;"x<("y<.=h=l===== >5 @5@^@@"@g@h@Crcs5.10.112.el8Revision Control System (RCS) file version management toolsThe Revision Control System (RCS) is a system for managing multiple versions of files. RCS automates the storage, retrieval, logging, identification and merging of file revisions. RCS is useful for text files that are revised frequently (for example, programs, documentation, graphics, papers and form letters). The rcs package should be installed if you need a system for managing different versions of files.h"&buildhw-x86-11.iad2.fedoraproject.org nFedora ProjectFedora ProjectGPL-3.0-or-laterFedora ProjectUnspecifiedhttp://www.gnu.org/software/rcs/linuxx86_64''P`96\9-K* O+/XG   AAAAA큤h"%h"%h"%h"%h"%h"%h"%h"%h"%h"%h"&h"&h"&h"&h"&h"&h"&h"&YBaHaHaa#h"%h"%h"%h"%h"%h"%h"%h"%h"%h"%h"%d527427c06edada447319842aec346f3224b0ef8ce35ea12f3dcef3e81f810708c27d9f6fb66621f52640e58a1fb289aeaee5d732dedb2e8d0e8277e1a1d55bafc0931f9f6c097e80bf1125235d7781ea5337cfc4123df6f262c088b70f37a1d883a36145fc08336b0bca96f1bb1975666c841f22f0cbd9af94023610480b515a5ed7e83473bb3d94a6f168294059ae6482927d273780db633c574efca72deec8a63203e99a33e5df24ed80ee34e1be9cf6f61538858d490ee39b3683dec32a4882ea70891f6ebc52b7a196782547b235339c0c16305234f283f62e98cb853c5543473060c236553ba2d1941d3b804bca60d33b3b29d5a5b5e7f01cbf1698a006f8bdc848e103accf79943e0dacfb352b34de2b1b0d0309a5d10cf29a4b7f2c278988c1a34d5761ec5fe1d2f1d25407cf890edf3f6e0a4e71b56939fbce032a98ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b903fbc72b8cd8b5a233efda4d42477789cc5029f768068e387b4536217070d4621a479f25c0b7f498e17b31c09872c25cd0c0903b2f8a2da1a35cd30288b65522369e2bc7c7749649810d989dbd8f7aed9c7a4ae8767f7d8bb437b35d308c7a6064447037f7ab4a924935190f669e9176d3e75f5310c7a8b1629a1a0864a6ce174ddccebcf99d6d7ec8978ada9b8f4b14bfc6faeac5e64e30f297cf75d303a16652a8397bd288fc2a8ea0c854287701a073e8fbcbd742eef58c292c9725e5c2133a6a786d2c1cf1f4efc21be247ac5d8bb4d6a1db0f5ef95dd76333e0392ca31453ae73c468f94604c24673362bdf0ad496d416a808abec6ab0b77a2f29c1f19b5a82bec1b2bc1dad637642bbfe826669eb347f6d14b4eead732d5a687fee0838e6d018d6740dc341e9bf95f24939cac740ecb9b362a07b86a75040f45f4479dee412e2cfd4fb2a99d7a0975af5f82271b532a57ee109d1353f5806764197fc43e8e3a36a3d9456a45234b6322a06a11e4e58ef1a63e8992f6e106cf9a2062c01cc77e5f1622183897a17a88d5b268df23be3e9c25c957c72a4e3c6ba32b4d1c290e41a4bd126113f5038c960e116ce61272aa9bdcb3b8ad60cdcff7134c1bb47576884a7c61562856e8f053ebc43b6d39d736b34eeadd067ce6a79fa5bcaa396e5../../../../usr/bin/ident../../../../usr/bin/merge../../../../usr/bin/rcsxx^X\, L5$ 5 xsgbVQE@4/# ythcWRFA50$ z u i d X S G B 6 1 %    { v j e Y T H C 7 2 & !    | w k f Z U I D 8 3 ' "    } x l g [ V J E 9 4 ( #     ~ y m h \ W K F : 5 ) $     zni]XLG;6*%{oj^YMH<7+& |pk_ZNI=8,' }ql`[OJ>9-( ~rma\PK?=AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  =AK  eoeoeoeoeoeoeoeoeoeoeoeoeoeoeoeoeoeo\DOeoOJ  eoOBt  Ք;lHs$eoVI Ր4eo5 h-dCDeo[H  eoM ;keomI\ f1t1eo5l -H2ՓeoN *|H5 n-eo[KH6 T +O -"!eo5eoN  5: -eoe7 oOO -eo _AL>eoeoG E8eosG`2 v0`OZp@=eoJh*}՛>~|eoKz o\/Ox eoF u O48<qx3q LEpeoJd o[СkeoL( j eopH\ e /(bO6@0aeoJ _*h<]0Y[eoLX1Z 7VeoH'U O/QeoJ Oդ$8IMXKeo9G<J FLIս6pkGeozG E O*ĭAH<AeoK?[$D=eoQH : 3,9eo7 5 34O =1eo J/#-jg+eo: ?* Eh)ՙ5h'ip&eo]Mt% O4!8*!3l eoJ( r#>peoM  6eoM3 NV.(eo.J (" eo3IHX ՗D 4 ]eoM zԇxMX.Lq $   5.8.1-2Honza Horak - 5.8.1-1Fedora Release Engineering - 5.8-2Honza Horak - 5.8-1Fedora Release Engineering - 5.7-37Ville Skyttä - 5.7-36Fedora Release Engineering - 5.7-35Fedora Release Engineering - 5.7-34Tom "spot" Callaway - 5.7-33Fedora Release Engineering - 5.7-32Jiri Moskovcak - 5.7-31Jesse Keating - 5.7-30.1Jesse Keating - 5.7-30Jesse Keating - 5.7-29.2.1Jesse Keating - 5.7-29.2Jesse Keating Phil Knirsch 5.7-29Phil Knirsch 5.7-28Florian La Roche 5.7-27Phil Knirsch 5.7-26Elliot Lee 5.7-25Elliot Lee 5.7-24Phil Knirsch 5.7-23Phil Knirsch 5.7-22Elliot Lee Tim Powers Tim Powers 5.7-19Tim Powers Tim Powers Tim Powers Elliot Lee Preston Brown Prospector Jeff Johnson Jeff Johnson Cristian Gafton Prospector System Cristian Gafton Erik Troan - Fix filter by user to fix BZ=#2364880- Rebuilt for https://fedoraproject.org/wiki/Fedora_42_Mass_Rebuild- Use autoreconf to fix BZ=#2330867- Rebuilt for https://fedoraproject.org/wiki/Fedora_41_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_40_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_40_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_39_Mass_Rebuild- Port configure script to C99- Rebuilt for https://fedoraproject.org/wiki/Fedora_38_Mass_Rebuild- SPDX- Rebuilt for https://fedoraproject.org/wiki/Fedora_37_Mass_Rebuild- Update to upstream 5.10.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_36_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_35_Mass_Rebuild- patch SIGSTKSZ- Rebuilt for https://fedoraproject.org/wiki/Fedora_34_Mass_Rebuild- Update to upstream 5.10.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_32_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_31_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_30_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Disable t810 test- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Append -stc=c99 to CFLAGS (Fix FTBFS).- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Update to upstream 5.9.4- Update to upstream 5.9.3- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Explicitly require texinfo during build- Update to upstream 5.9.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Update to upstream 5.9.0- Update to upstream 5.8.2 - Fix some man page vs. help incompatibilities- Remove sendmail from build requirements, it's not configured to be used Related: #903368- Use make DESTDIR=... install instead of %make_install- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Provides: bundled(gnulib) added, as per #821786 - minor spec file clean up - install-info run in postin/postun- Update x=XQLP8>$>>> - 11.2.0-0.devel.7.24ea81aPeter Robinson 11.2.0-0.devel.6.5e3edd4Igor Gnatenko - 11.2.0-0.devel.5.5e3edd4Adam Jackson Igor Gnatenko - 11.2.0-0.devel.3.70d8dbcIgor Gnatenko - 11.2.0-0.devel.2.56aff6bIgor Gnatenko - 11.2.0-0.devel.1.86fc97dIgor Gnatenko - 11.1.0-0.devel.13.5ae37aeAdam Jackson 11.1.0-0.devel.12.3994ef5Igor Gnatenko - 11.1.0-0.devel.11.3994ef5Igor Gnatenko - 11.1.0-0.devel.10.7182498Igor Gnatenko - 11.1.0-0.devel.9.4a168adIgor Gnatenko - 11.1.0-0.devel.8.4a168adIgor Gnatenko - 11.1.0-0.devel.7.47d1199Igor Gnatenko - 11.1.0-0.devel.6.9932142Igor Gnatenko - 11.1.0-0.devel.5.47e18a5Igor Gnatenko - 11.1.0-0.devel.4.d6fbcf6Rex Dieter - 11.1.0-0.devel.3.60aea30Igor Gnatenko - 11.1.0-0.devel.2.60aea30Igor Gnatenko - 11.1.0-0.devel.1.4e5752eIgor Gnatenko - 11.0.0-0.devel.2.21ccdbdIgor Gnatenko - 11.0.0-0.devel.1.6f2d889Peter Robinson 10.7.0-0.devel.4.ea633dbIgor Gnatenko - 10.7.0-0.devel.3.ea633dbIgor Gnatenko - 10.7.0-0.devel.2.8787141Igor Gnatenko - 10.7.0-0.devel.1.8787141Fedora Release Engineering - 10.6.0-0.devel.7.5a55f68.1Igor Gnatenko - 10.6.0-0.devel.7.5a55f68Igor Gnatenko - 10.6.0-0.devel.6.5a55f68Igor Gnatenko - 10.6.0-0.devel.5.51e3453Igor Gnatenko - 10.6.0-0.devel.4.c1485f4Adam Jackson 10.6.0-0.devel.3Rob Clark - 10.6.0-0.devel.1.f80af89Igor Gnatenko - 10.5.0-1.20150218Igor Gnatenko - 10.5.0-0.devel.32.6171131Igor Gnatenko - 10.5.0-0.devel.31.c3260f8Igor Gnatenko - 10.5.0-0.devel.30.290553bIgor Gnatenko - 10.5.0-0.devel.28.b77eaafIgor Gnatenko - 10.5.0-0.devel.26.c633528Igor Gnatenko - 10.5.0-0.devel.25.a6f6d61Igor Gnatenko - 10.5.0-0.devel.23.be0311cIgor Gnatenko - 10.5.0-0.devel.21.609c3e5Igor Gnatenko - 10.5.0-0.devel.19.3ba57baIgor Gnatenko - 10.5.0-0.devel.17.64dcb2bIgor Gnatenko - 10.5.0-0.devel.15.6c18279Igor Gnatenko - 10.5.0-0.devel.13.0c7f895Igor Gnatenko - 10.5.0-0.devel.11.cb5a372Igor Gnatenko - 10.5.0-0.devel.10.git0d7f4c8Dan Horák 10.5.0-0.devel.9Adam Jackson 10.5.0-0.devel.8Igor Gnatenko - 10.5.0-0.devel.7.git0d7f4c8Igor Gnatenko - 10.5.0-0.devel.6.git0d7f4c8Igor Gnatenko - 10.5.0-0.devel.5.git29c7cf2Adam Jackson 10.5.0-0.devel.4Igor Gnatenko - 10.5.0-0.devel.3.git29c7cf2Igor Gnatenko - 10.5.0-0.devel.2.git3d9c1a9Igor Gnatenko - 10.5.0-0.x@-XL1haH$!Hh ?p?d# / b      U X\af(89:GlHpItXxY\]^bd3e8f;l=tXu\v`| \`dghhlCcpanel-perl-542-scope-guard0.211.cp130~el8CPAN module - lexically-scoped resource managementCpanel build perl module 'Scope::Guard'lexically-scoped resource managementhbh-centos-8.dev.cpanel.netperlcpanel/perlhttps://metacpan.orglinuxnoarchҁ$Uf42cfc0757ebe48718eba98460b697a0170c349ae1de36849ed22e13a82c76e1rootrootcpanel-perl-542-scope-guard-0.21-1.cp130~el8.src.rpmcpanel-perl(Scope::Guard)cpanel-perl-542-scope-guardcpanel-perl-scope-guard     cpanel-perl-542rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@V<@Q+R@Busy Camels - 0.21-1.cp130Busy Camels - 0.21-1.cp108Busy Camels - 0.21-1.cp1198Todd Rinaldo - 0.21-1.cp1156Todd Rinaldo - 0.20-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Scope-Guard 0.21- Update from upstream: Scope-Guard 0.200.210.21-1.cp130~el80.21Guard.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Scope/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-80db537ebb72e96bb8a70c68c1b3438a50ed0d28468a402b67289d677282dafdb?|S:ὲjJef557075fb64f5da4e5009fdad24847b05e25cfb56815b321b8f789a40325b3f5c0868ef3b6c7dd5aae65506e0cc3e73d9fd1095ej{lj{U ,X8f ,X:X11:D@1/ {+1pX.pmf _X.ht_iX-hpterm-color29_KsX-hpterm BJA.X0-lElQll`lnWww.xml <0-kEkQkk`kdWww.php.42WrongNumberOfParameters.pm2w Writers.pmRL_,  _WriterException.phpf(#BpMd Writer.pm , ,, Writer.php09_- WriteError.pm $d WriteAll.pmjnWrite.so_jOWrite.pmdfs Wrapper.pm))2 WrapTie.pmXu WrapCGI.pmXH3)c<B jMoWrap.pmrs/WpCli.pmX Worries.pm09_  Worksheet.pms}_ Worker.pm  Workbook.pmonFKK.Words.pmtxXuL@@'$_spec (Jan Silhan) - doc: mentioning raising IOError from Base.fill_sack() (Jan Silhan) - option_parser: fixed splitting multiple values (RhBug:1186710) (Jan Silhan) - AUTHORS: updated (Jan Silhan) - Standardize words describing boolean data type (Christopher Meng)- Adapt to librepo-1.7.13, metalink and mirrorlist are not loaded anymore when the repo is local. (Radek Holy) - not raises value error when no metadata exist (Jan Silhan) - Remove lock files during boot (RhBug:1154476) (Michal Luscon) - doc: groups are ordered not categories (Jan Silhan) - doc: added Package attributes to API (Jan Silhan) - README: link to bug reporting guide (Jan Silhan) - README: the official documentation is on readthedoc (Jan Silhan) - i18n: unicode encoding does not throw error (RhBug:1155877) (Jan Silhan) - conf: added minrate repo option (Related:RhBug:1175466) (Jan Silhan) - conf: added timeout repo option (RhBug:1175466) (Jan Silhan) - doc: api_queries: add 'file' filter description (RhBug:1186461) (Igor Gnatenko) - doc: documenting enablegroups (Jan Silhan) - log: printing metadata timestamp (RhBug:1170156) (Jan Silhan) - base: setup default cachedir value (RhBug:1184943) (Michal Luscon) - orders groups/environments by display_order tag (RhBug:1177002) (Jan Silhan) - no need to call create_cmdline_repo (Jan Silhan) - base: package-spec matches all packages which the name glob pattern fits (RhBug:1169165) (Michal Luscon) - doc: move dnf.conf to appropriate man page section (RhBug:1167982) (Michal Luscon) - tests: add test for blocking process lock (Michal Luscon) - lock: fix several race conditions in process lock mechanism (Michal Luscon) - base: use blocking process lock during download phase (RhBug:1157233) (Michal Luscon) - Update the Source0 generation commands in dnf.spec.in file (Parag Nemade) - Enhancement to dnf.spec.in file which follows current fedora packaging guidelines (Parag Nemade) - doc: add some examples and documentation of the core use case (RhBug:1138096) (Radek Holy) - bash-completion: enable downgrading packages for local files (RhBug:1181189) (Igor Gnatenko) - group: prints plain package name when package not in any repo (RhBug:1181397) (Jan Silhan) - spec: own __pycache__ for python 3 (Igor Gnatenko) - changed hawkey.log dir to /var/log (RhBug:1175434) (Jan Silhan) - bash-completion: handle sqlite errors (Igor Gnatenko) - use LANG=C when invoking 'dnf help' and 'sed' with regular expressions (Jakub Dorňák) - spec: own __pycache__ directory for py3 (Igor Gnatenko) - doc: mentioning Install command accepts path to local rpm package (Jan Silhan) - groups: in erase and install cmd non-existent group does not abort transaction (Jan Silhan) - doc: running tests in README (Jan Silhan) - api: transaction: added install_set and remove_set (RhBug:1162887) (Jan Silhan) - cosmetic: fixed some typos in documentation (Jan Silhan) - groups: environments described after @ sign works (RhBug:1156084) (Jan Silhan) - own /etc/dnf/protected.d (RhBug:1175098) (Jan Silhan) - i18n: computing width of char right (RhBug:1174136) (Jan Silhan) - cosmetic: renamed _splitArg -> _split_arg (Jan Silhan) - conf: removed include name conflict (RhBug:1055910) (Jan Silhan) - output: removed unpredictable decision based on probability introduced in ab4d2c5 (Jan Silhan) - output: history list is not limited to 20 records (RhBug:1155918) (Jan Silhan) - doc: referenced forgotten bug fix to release notes (Jan Silhan) - cosmetic: doc: removed duplicated word (Jan Silhan) - doc: described unavailable package corner case with skip_if_unavailable option (RhBug:1119030) (Jan Silhan) - log: replaced size with maxsize directive (RhBug:1177394) (Jan Silhan) - spec: fixed %ghost log file names (Jan Silhan)- logging: reverted naming from a6dde81- transifex update (Jan Silhan) - bash-completion: don't query if we trying to use local file (RhBug:1153543) (Igor Gnatenko) - bash-completion: fix local completion (RhBug:1151231) (Igor Gnatenko) - bash-completion: use sqlite cache from dnf-plugins-core (Igor Gnatenko) - base: output a wx0 X,L5:$%5: @?d%, B e  &=CLT X \ d  t4(UG\HdIlJnXpY|\]^b)defltuvwxyH XH KghCplesk-libboost-program-options1.821.82.01centos.7.230425.0721Boost program_options C++ library.This package contains Boost program_options shared multithreaded library.dG`bcos7x64.aws.plesk.techPleskBoost Software Licence v1.0Plesk System Environment/Librarieshttps://www.plesk.com/linuxx86_646AdG`%F@c6b9425e2ba46d9ac0fd5f748714628drootrootrootrootplesk-libboost-program-options1.82-1.82.0-1centos.7.230425.0721.src.rpmlibboost_program_options-plesk.so.1.82.0()(64bit)plesk-libboost-program-options1.82plesk-libboost-program-options1.82(x86-64)@@@@@@@@@@@@@@@@@@  libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libm.so.6()(64bit)libpthread.so.0()(64bit)librt.so.1()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(CXXABI_1.3.9)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.11)(64bit)libstdc++.so.6(GLIBCXX_3.4.20)(64bit)libstdc++.so.6(GLIBCXX_3.4.21)(64bit)libstdc++.so.6(GLIBCXX_3.4.29)(64bit)libstdc++.so.6(GLIBCXX_3.4.9)(64bit)plesk-libboost-1.82rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)3.0.4-14.0-14.11.3/1.82.0-1centos.7.230425.07211.82.0-1centos.7.230425.0721libboost-plesk-1.82libboost_program_options-plesk.so.1.82.0/usr/lib64//usr/lib64/libboost-plesk-1.82/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpiogzip9x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=d953ebd2d5f2b15c50db7f0b271a1118d0739de8, strippedPRRRRRR RR RR RR RR RRRR?A ~eu>)?FdGj K~?Q-;_n*[j|̐΀,=U h,FdGj K~*Ë~$n8ȖE|;{)EBæ(?fZq;+910fc2a3e4d54455b0ad77d6751d9579c3b33b08fjq/fj`on2.7/curses//L/%/usr/lib64/python2.7/ctypes/macholib/Ke/usr/lib64/python2.7/ctypes/eJ /usr/lib64/python2.7/config/eIy/usr/lib64/python2.7/compiler/ib6H//usr/lib64/python2.7/bsddb/e_G/usr/lib64/python2.7/7m/usr/lib64/pm-utils/sleep.d/6fpkrBcsy t|]qvz e{ i/usr/lib64/pkgconfig/t e3/usr/lib64/perl5/vendor_perl/auto/XML/Parser/Expat/at p-/usr/lib64/perl5/vendor_perl/auto/XML/Parser/xXL$!ros.com> - 1.0-99Julian Brown - 1.0-98Julian Brown - 1.0-97Julian Brown - 1.0-96Julian Brown - 1.0-95Brian Mendoza - 1.0-94Brian Mendoza - 1.0-93Dan Muey - 1.0-92Sloane Bernstein - 1.0-91Dan Muey - 1.0-90Dan Muey - 1.0-89Sloane Bernstein - 1.0-88Julian Brown - 1.0-87Dan Muey - 1.0-86Brian Mendoza - 1.0-85Travis Holloway - 1.0-84Brian Mendoza - 1.0-83Julian Brown - 1.0-82Julian Brown - 1.0-81Brian Mendoza - 1.0-80Julian Brown - 1.0-79Dan Muey - 1.0-78Julian Brown - 1.0-77Brian Mendoza - 1.0-76Dan Muey - 1.0-75Dan Muey - 1.0-74Julian Brown - 1.0-73Dan Muey - 1.0-72Brian Mendoza - 1.0-71Julian Brown - 1.0-70Dan Muey - 1.0-69Tim Mullin - 1.0-68Sloane Bernstein - 1.0-67Dan Muey - 1.0-66Dan Muey - 1.0-65Dan Muey - 1.0-64Dan Muey - 1.0-63Brian Mendoza - 1.0-62Julian Brown - 1.0-61Julian Brown - 1.0-60Julian Brown - 1.0-59Julian Brown - 1.0-58Dan Muey - 1.0-57Julian Brown - 1.0-56Julian Brown - 1.0-55Dan Muey - 1.0-54Dan Muey - 1.0-53Dan Muey - 1.0-52Dan Muey - 1.0-51Dan Muey - 1.0-50Dan Muey - 1.0-49Dan Muey - 1.0-48Dan Muey - 1.0-47Dan Muey - 1.0-46Travis Holloway - 1.0-45Daniel Muey - 1.0-44Julian Brown - 1.0-43Travis Holloway - 1.0-42Daniel Muey - 1.0-41Daniel Muey - 1.0-40Cory McIntire - 1.0-39Daniel Muey - 1.0-38Daniel Muey - 1.0-37Daniel Muey - 1.0-36Daniel Muey - 1.0-35Daniel Muey - 1.0-34Daniel Muey - 1.0-33Daniel Muey - 1.0-32Julian Brown - 1.0-31Daniel Muey - 1.0-30Tim Mullin - 1.0-29Tim Mullin - 1.0-28Daniel Muey - 1.0-27Cory McIntire - 1.0-26Julian Brown - 1.0-25Daniel Muey - 1.0-24J. Nick Koston - 1.0-23J. Nick Koston - 1.0-22Daniel Muey - 1.0-21Daniel Muey - 1.0-20Tim Mullin - 1.0-19Daniel Muey - 1.0-18Dan Muey - 1.0-17Dan Muey - 1.0-16Cory McIntire - 1.0-15Dan Muey - 1.0-14Charan Angara - 1.0-13Dan Muey - 1.0-12Dan Muey - 1.0-11Dan Muey - 1.0-10Jacob Perkins - 1.0-9Dan Muey - 1.0-8Dan Muey - 1.0-7S. Kurt Newman - 1.0-6Dan Muey - 1.0-5Dan Muey - 1.0-4Julian Brown - 1.0-3Julian Brown - 1.0-2Julian Brown - 1.0-1- EA4-278: Updax XLUI$EUIVI e - 3.0.3-1.cp1174- Fix internal deps generated on RPM- Update to upstream release 3.3.15 - Add support for Ubuntu 24.04 and AlmaLinux 10- Include missing headers and manpages in Ubuntu package- Upstream update to version 3.3.13 - Require support for libzstd.- Upstream update to version 3.3.1- Add RedHat 9 & Ubuntu 22 support.- Upstream update to release 3.2.6- Update for debian support- Add requires for libcurl so that the remote-io plugin can always build correctly- Update to upstream realease 3.1.8- Update to upstream realease 3.1.7- use cmake from system instead of cpanel-cmake- remove backward compatibility, need to rebuild using the new libraries- adjust obsoletes rules- update from mariadb-native-clientcpanel-mariadb-native-client 3.3.15-2.cp130~el83.3.15-2.cp130~el83.3.153.3.15libmariadb.solibmariadb.so.3libmysqlclient.solibmysqlclient_r.soauth_gssapi_client.socaching_sha2_password.soclient_ed25519.sodialog.somysql_clear_password.soremote_io.sosha256_password.sozstd.so/usr/local/cpanel/3rdparty/lib/mariadb//usr/local/cpanel/3rdparty/lib/mariadb/plugin/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2343d463520c109a0baebfecf66dfda7b3a6902e, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7c44b3f37302edeeffc15b047e1960d317760d82, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a86d6e7ed403dba2127407c2d35b4954474cc676, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=147cb59994a01a405b380743a657a51367cbc51e, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a03c74e9b8901846dfa96b3e62b05cc6c845f03d, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=da349056d7970a48bf353e69ff71f0512eec0a38, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b69ff708bd86fbc886413f7f372d0423e90c640b, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5dff4b6436d24b886d44e738b850235e340a477e, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8b9ac05132edfaf2cd92b072e294972bb818f55d, not strippedutf-8b333f946498fde157b3846517d4190b203680add78ef968965ab47e44867f04b?@Kn*B \Q"pe5#ݵ3q #)GH a%&χA(wVnn^W`+hztA@_;xz[ɱB2)alsgE]iUPڒ sG^oXX~1V٧5?Lݲw)x-v/~Fr;U4$b;23`+Ws ^ T1B?f`X\[5M<2*U2}Nrr-vVLE)S8̈Z$2>^u-cvt}7x.+A&zmQ ,)Xa^^*)&ŘQ 8Uvz %gSn˪;s|!<ΰQd~aaE Qd~ WBtSP3q'E.[DǞ` s+ s?<  0xq<p8yp4j7*+%}߉n-A|B(Ͳ Z8rDl:[!%}BE/iVI :/h.XX["Q˔2>kI@9 |ASHAt8ʹ J*ndO' 0 j̥ˇ]D( Gy=6 nP8ĝrp40ens:@}ؿUXR<*zQ"sA_T1ZfXɑxgECs̘$xooMm> Cѐ82a006a97fdf236d238db64ca4983cb0f9210a1de3b83f8db9dec16a9a0a22725e9f51b0a6c5c1a262b29647df5636a6c0b8e13e5j{x j{xio1.resstio1.c*fio.pyogQ"Q$sio.pyi,)io.pyc-of@(Q QQQovrio.pywio.pngf3io.js_fio.hz(QQQQgvkio.cpython-39.pycxXKLjh?T$'TTTes- New module to search for and change ifcfg files for interfaces not under control of NM - firewall_config: Enhanced messages in status bar - firewall-config: New message window as overlay if not connected - firewall-config: Fix sentivity of option, view menus and main paned if not connected - firewall-applet: Quit on SIGINT (Ctrl-C), reduced D-Bus calls, some cleanup - firewall-[offline]cmd: Show target in zone information - D-Bus: Completed masquerade methods in FirewallClientZoneSettings - Fixed log-denied rules for icmp-blocks - Keep sorting of interfaces, services, icmp-blocks and other settings in zones - Fixed runtime-to-permanent not to save interfaces under control of NM - New icmp-block-inversion flag in the zones - ICMP type filtering in the zones - New services: sip, sips, managesieve - rich rules: Allow destination action (RHBZ#1163428) - firewall-offline-cmd: New option -q/--quiet - firewall-[offline-]cmd: New --add-[zone,service,ipset,icmptype]-from-file - firewall-[offline-]cmd: Fix option for setting the destination address - firewall-config: Fixed resizing behaviour - New transaction model for speed ups in start, restart, stop and other actions - firewall-cmd: New options --load{zone,service,ipset,icmptype}-defaults - Fixed memory leak in dbus_introspection_add_properties - Landscape.io fixes, pylint calm downs - New D-Bus getXnames methods to speed up firewall-config and firewall-cmd - ebtables-restore: No support for COMMIT command - Source port support in services, zones and rich rules - firewall-offline-cmd: Added --{add,remove}-entries-from-file for ipsets - firewall-config: New active bindings side bar for simple binding changes - Reworked NetworkManager module - Proper default zone handling for NM connections - Try to set zone binding with NM if interface is under control of NM - Code cleanup and bug fixes - Include test suite in the release and install in /usr/share/firewalld/tests - New Travis-CI configuration file - Fixed more broken frensh translations - Translation updates- Fixed ebtables-restore does not support the COMMIT command issue- Fixed translations with python3 - Fixed exception for failed NM import, new doc string - Make ipsets visible per default in firewall-config - Install new fw_nm module - Do not fail if log file could not be opened - Fixed broken fr translation- Enhancements of ipset handling - No cleanup of ipsets using timeouts while reloading - Only destroy conflicting ipsets - Only use ipset types supported by the system - Add and remove several ipset entries in one call using a file - Reduce time frame where builtin chains are on policy DROP while reloading - Include descriptions in --info-X calls - Command line interface support to get and alter descriptions of zones, services, ipsets and icmptypes with permanent option - Properly watch changes in combined zones - Fix logging in rich rule forward rules - Transformed direct.passthrough errors into warnings - Rework of import structures - Reduced calls to get ids for port and protocol names (RHBZ#1305434) - Build and installation fixes by Markos Chandras - Provide D-Bus properties in introspection data - Fix for flaws found by landscape.io - Fix for repeated SUGHUP - New NetworkManager module to get and set zones of connections, used in firewall-applet and firewall-config - configure: Autodetect backend tools ({ip,ip6,eb}tables{,-restore}, ipset) - Code cleanups - Bug fixes- Revert one commit to temporary work-around RHBZ#1309754- Make sure tempdir is created even in offline mode. (RHBZ#1305175)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Version 0.4.0 - Speed ups - ipset support - MAC address support - Log of denied packets - Mark action in rich rules - Enhanced alteration of config files with command line tools - Use of zone chains in direct interface - firewall-applet enhancement - New services: ceph-mon, ceph, docker-registry, imap, pop3, pulseaudio, smtps, snmptrap, snmp, syslog-tls and syslog - Several bug fixes - CxXLXx$+prefix interface in libselinux- Update from upstream * Merged seuser/user_extra support patch to semodule_package from Joshua Brindle. * Merged getopt type fix for semodule_link/expand and sestatus from Chris PeBenito. - Fix genhomedircon output- rebuilt for new gcc4.1 snapshot and glibc changes- Add auditing to semanage- Update from upstream * Merged clone record on set_con patch from Ivan Gyurdiev.- Update from upstream * Merged genhomedircon fix from Dan Walsh. * Merged seusers.system patch from Ivan Gyurdiev. * Merged improve port/fcontext API patch from Ivan Gyurdiev. * Merged genhomedircon patch from Dan Walsh.- Update from upstream * Merged newrole audit patch from Steve Grubb. * Merged seuser -> seuser local rename patch from Ivan Gyurdiev. * Merged semanage and semodule access check patches from Joshua Brindle.- Add a default of /export/home- Cleanup of the patch- Correct handling of symbolic links in restorecon- Added translation support to semanage - Update from upstream * Modified newrole and run_init to use the loginuid when supported to obtain the Linux user identity to re-authenticate, and to fall back to real uid. Dropped the use of the SELinux user identity, as Linux users are now mapped to SELinux users via seusers and the SELinux user identity space is separate. * Merged semanage bug fixes from Ivan Gyurdiev. * Merged semanage fixes from Russell Coker. * Merged chcat.8 and genhomedircon patches from Dan Walsh.- Fix genhomedircon to work on MLS policy- Update to match NSA * Merged chcat, semanage, and setsebool patches from Dan Walsh.- Fixes for "add"-"modify" error messages - Fixes for chcat- Add management of translation file to semaange and seobject- Fix chcat -l -L to work while not root- Update to match NSA * Merged semanage fixes from Ivan Gyurdiev. * Merged semanage fixes from Russell Coker. * Merged chcat, genhomedircon, and semanage diffs from Dan Walsh.- Update chcat to manage user categories also- Add check for root for semanage, genhomedircon- Add ivans patch- Update to match NSA * Merged newrole cleanup patch from Steve Grubb. * Merged setfiles/restorecon performance patch from Russell Coker. * Merged genhomedircon and semanage patches from Dan Walsh. * Merged remove add_local/set_local patch from Ivan Gyurdiev.- Fixes for mls policy- Update semanage and split out seobject - Fix labeleing of home_root- Update to match NSA * Added filename to semodule error reporting.- Update to match NSA * Merged genhomedircon and semanage patch from Dan Walsh. * Changed semodule error reporting to include argv[0].- Update to match NSA * Merged semanage getpwnam bug fix from Serge Hallyn (IBM). * Merged patch series from Ivan Gyurdiev. This includes patches to: - cleanup setsebool - update setsebool to apply active booleans through libsemanage - update semodule to use the new semanage_set_rebuild() interface - fix various bugs in semanage * Merged patch from Dan Walsh (Red Hat). This includes fixes for restorecon, chcat, fixfiles, genhomedircon, and semanage.- Fix restorecon to not say it is changing user section when -vv is specified- Fixes for semanage, patch from Ivan and added a test script- Fix getpwnam call- Anaconda fixes- Turn off try catch block to debug anaconda failure- More fixes for chcat- Add try catch for files that may not exists- Remove commands from genhomedircon for installer- Fix genhomedircon to work in installer - Update to match NSA * Merged patch for chcat script from Dan Walsh.- More fixes to chcat- rebuilt- Update to match NSA * Merged fix for audit2allow long option list from Dan Walsh. * Merged -r option for restorecon (alias for -R) from Dan WalxX/ LH`A$p`A_AaAllagh@redhat.com> - 2.0.0-3Stephen Gallagher - 2.0.0-2Stephen Gallagher - 2.0.0-1Stephen Gallagher - 2.0.0-0.beta2Stephen Gallagher - 2.0.0-0.beta1Stephen Gallagher - 1.6.2-2Stephen Gallagher - 1.6.2-1Florian Weimer - 1.6.1-2Stephen Gallagher - 1.6.1-1Stephen Gallagher - 1.6.0-1Fedora Release Engineering - 1.5.2-2Stephen Gallagher - 1.5.2-1Stephen Gallagher - 1.5.1-2Stephen Gallagher - 1.5.1-1Stephen Gallagher - 1.5.0-2Stephen Gallagher - 1.5.0-1Stephen Gallagher - 1.4.1-1Stephen Gallagher - 1.4.0-2Stephen Gallagher - 1.4.0-1Stephen Gallagher - 1.3.0-2Stephen Gallagher - 1.3.0-1Stephen Gallagher - 1.2.0-1Stephen Gallagher - 1.1.3-2Stephen Gallagher - 1.1.3-1Stephen Gallagher - 1.1.2-1Stephen Gallagher - 1.1.1-1Stephen Gallagher - 1.1.0-1Igor Gnatenko - 1.0.4-2Stephen Gallagher - 1.0.4-1Stephen Gallagher - 1.0.3-1Stephen Gallagher - 1.0.2-1Stephen Gallagher - 1.0.1-2Stephen Gallagher - 1.0.1-1Stephen Gallagher - 0.2.2-1Igor Gnatenko - 0.2.1-3Igor Gnatenko - 0.2.1-2Stephen Gallagher - 0.2.1-1Stephen Gallagher - 0.2.0-2Stephen Gallagher - 0.2.0-1Igor Gnatenko - 0.1.0-5Stephen Gallagher - 0.1.0-4Stephen Gallagher - 0.1.0-3Stephen Gallagher - 0.1.0-2- 2.13.0 bump (bug #1984402)- 2.12.1 bump (bug #1894573)- Update to 2.9.4 - Drop valgrind tests from RPM build - Resolves: RHBZ#1797749- Update to versions 2.8.2 and 1.8.16 - Resolves: rhbz#1752511- Improve default merging logic when dealing with third-party repos - Resolves: rhbz#1761805- Fix memory corruption error using Module.search_rpms() from python - Speed up valgrind tests - Resolves: rhbz#1714766- Rebase to 2.5.0 and 1.8.11 - Related: rhbz#1693680- Rebase to 2.4.0 and 1.8.10 - Resolves: rhbz#1693680- Don't fail merges when default streams differ - Resolves: rhbz#1666871- Include modified value when copying Defaults objects - Resolves: rhbz#1665465- Keep libmodulemd1 in sync with libmodulemd- Fix package location of modulemd-validator- Update to 2.0.0 final - Assorted fixes for validation - Add modulemd-validator tool based on v2 code - Fix a crash when merging defaults - Add missing BuildRequires- Update to 2.0.0beta2 - Better validation of stored content during read and write operations - ModuleIndex now returns FALSE if any subdocument fails - Fix tests on 32-bit platforms - Make unknown keys in YAML maps non-fatal for libmodulemd1 - Make unknown keys in YAML maps optionally fatal for libmodulemd 2.x - Fix RPM version requirements for libmodulemd1- Total rewrite to 2.0 API - Resolves: rhbz#1646436- Fix backwards-incompatible API change - Resolves: rhbz#1607083- Update to 1.6.2 - Make buildorder a signed integer to match modulemd specification - Obsolete unsupported pythonX-modulemd packages- Honor %{valgrind_arches}- Update to 1.6.1 - Fix header include ordering - Suppress empty sections from .dump() ordering- Update to 1.6.0 - Adds Modulemd.ModuleStream object, deprecating Modulemd.Module - Adds Modulemd.Translation and Modulemd.TranslationEntry objects - Adds Modulemd.ImprovedModule object that collects streams, defaultsxxX Lxu$eutx) PR PPPR R R RRRRRRRRRRRRutf-86b5b16a1cafaee7904bc7f5490694905231e7140e7e3766eb78a3435ee2bf947?@68` Qd~Li 1,&2`<>P<ʣT5I쭨CqNId?\5l'g< N ȍqHy7A )&<*.!X)Lc42!7 vKm8~1^\%0Z3Th"tC`1.(W|=Ø-"aqAw.^d 9~-A(U95 ;o}jݍ# W54-q~&Ѩk]N)#ԫ]:cb[Y~J7SDGw`o  bQw4&mBQ!vx/mli_M3: n6s`!xubw#+kCsBӲ` Qd~ lO'c!Cq|qB5V)ur*!)D#"yĄ'T4-4;̌=W7Zp.,|?<>}^n)DE $7;b,bvVzm\岺WrP ˡ2K h]*L7^|c >R6iFN;'Qlup pM._G%c?pMe [bOڇni^m93V<7ԳDY9)ua~Z8OnbJ Pq`5.O6 x˭7WIW`ѾscFxrTd7<|"i܉(P_4ac1ce67acad60a35a7732769dd9c32252f1d500f4602cb269dfc41e84b8cb3fbf585746b197fa8013c61f7be334f18c0cbc38b9j{xڌj{xoe tperl-ExtUtils-ParseXSoperl-ExtUtils-MiniperlJoetperl-ExtUtils-Manifeste Onperl-ExtUtils-MakeMakerrtrperl-ExtUtils-Installnperl-ExtUtils-Embed R6perl-ExtUtils-CommandIperl-ExtUtils-CBuilder Re6 perl-Exporterl perl-ErrnoIDCvperl-Envv3perl-Encode-devel- perl-Encodees_perl-Digest-SHAs:pperl-Digest-MD5b - perl-Digestttpperl-Devel-SelfStubber_Ma-perl-Devel-Peekbumperl-Devel-PPPort tperl-Data-Dumperu r perl-DB_Filec iperl-Config-Perl-V1.6 1perl-Compress-Raw-Zliboad perl-Compress-Raw-Bzip2dre perl-Carpoperl-CPAN-Meta-YAMLt.dperl-CPAN-Meta-Requirements Rhperl-CPAN-Metaect*Jperl-IO-Socket-IP)-perl-IO-Compress@(9perl-IOrt'rperl-HTTP-Tiny2J&operl-Getopt-Long9%Dperl-Filter-Simplet.c$0 perl-Filterrt#operl-File-Tempton"dperl-File-PathEll!pperl-File-Fetchoe tperl-ExtUtils-ParseXSoperl-ExtUtils-MiniperlJoetperl-ExtUtils-Manifeste Onperl-ExtUtils-MakeMakerrtrperl-ExtUtils-Installnperl-ExtUtils-Embed R6perl-ExtUtils-CommandIperl-ExtUtils-CBuilder Re6 perl-Exporterl perl-ErrnoIDCvperl-Envv3perl-Encode-devel- perl-Encodees_perl-Digest-SHAs:pperl-Digest-MD5b - perl-Digestttpperl-Devel-SelfStubber_Ma-perl-Devel-Peekbumperl-Devel-PPPort tperl-Data-Dumperu r perl-DB_Filec iperl-Config-Perl-V1.6 1perl-Compress-Raw-Zliboad perl-Compress-Raw-Bzip2dre perl-Carpoperl-CPAN-Meta-YAMLt.dperl-CPAN-Meta-Requirements Rhperl-CPAN-Metaecte perl-CPANR perl-B-Debugsoperl-Attribute-Handlersssuperl-Archive-Tar.> HZm} 13$DH NU(> perl(warnings)U' perl(version)/:t: N`iq =  7 perl(vars)087H3#s perl(utf8)ongxXL:@9$)999_attrs.patch- Adjust dependency on crypto-polices to be just the file we want - Patch courtesy of lslebodn - Resolves: #1308984- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Replace _kadmin/_kprop with systemd macros - Remove traces of upstart from fedora package per policy - Resolves: #1290185- Fix CVE-2015-8629, CVE-2015-8630, CVE-2015-8631- Make krb5kdc.log not world-readable by default - Resolves: #1276484- Allow verification of attributes on krb5.conf- Use "new" systemd macros for service handling. (Thanks vpavlin!) - Resolves: #850399- Remove WITH_NSS macro (always false) - Remove WITH_SYSTEMD macro (always true) - Remove WITH_LDAP macro (always true) - Remove WITH_OPENSSL macro (always true)- Backport fix for chrome crash in spnego_gss_inquire_context - Resolves: #1295893- Backport patch to fix mechglue for gss_inqure_attrs_for_mech()- Backport interposer fix (#1284985) - Drop workaround pwsize initialization patch (gcc has been fixed)- Fix FTBFS by no longer working around bug in nss_wrapper- Upstream release. No actual change from beta, just version bump - Clean up unused parts of spec file- New upstream beta version- Patch CVE-2015-2698- Patch CVE-2015-2697, CVE-2015-2696, CVE-2015-2695- Ensure pwsize is initialized in chpass_util.c- Fix typo of crypto-policies file in previous version- Start using crypto-policies- TEMPORARILY disable usage of OFD locks as a workaround for x86- New upstream beta version- Work around KDC client prinicipal in referrals issue (#1259844)- Enable building with bad system /etc/krb5.conf- Drop dependency on pax, ksh - Remove support for fedora < 20- Nix /usr/share/krb5.conf.d to reduce complexity- Depend on crypto-policies which provides /etc/krb5.conf.d (#1225792)- Remove dependency on systemd-sysv which is no longer needed for fedora > 20 This also fixes a fail-to-build issue. - Miscalaneous spec cleanup fixes- Support config snippets in /etc/krb5.conf.d/ and /usr/share/krb5.conf.d/ (#1225792, #1146370, #1145808)- Use system nss_wrapper and socket_wrapper for testing. Patch by Andreas Schneider - Remove Zanata test glue and related workarounds - Bug #1234292 ("IPA server cannot be run in container due to incorrect /usr/sbin/_kadmind") - Bug #1234326 ("krb5-server introduces new rpm dependency on ksh")- Fix dependicy on binfmt.service- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Add patch to fix Redhat Bug #1227542 ("[SELinux] AVC denials may appear when kadmind starts"). The issue was caused by an unneeded |htons()| which triggered SELinux AVC denials due to the "random" port usage.- Add fix for RedHat Bug #1164304 ("Upstream unit tests loads the installed shared libraries instead the ones from the build")- Update to krb5-1.13.2 - drop patch for krb5-1.13.2-CVE_2015_2694_requires_preauth_bypass_in_PKINIT_enabled_KDC, fixed in krb5-1.13.2 - drop patch for krb5-1.12.1-CVE_2014_5355_fix_krb5_read_message_handling, fixed in krb5-1.13.2 - Add script processing for upcoming Zanata l10n support - Minor spec cleanup- fix for CVE-2015-2694 (#1216133) "requires_preauth bypass in PKINIT-enabled KDC". In MIT krb5 1.12 and later, when the KDC is configured with PKINIT support, an unauthenticated remote attacker can bypass the requires_preauth flag on a client principal and obtain a ciphertext encrypted in the principal's long-term key. This ciphertext could be used to conduct an off-line dictionary attack against the user's password.- Add temporay workaround for RH bug #1204646 ("krb5-config returns wrong -specs path") which modifies krb5-config post build so that development of krb5 dependicies gets unstuck. This MUST be removed before rawhide becomes F23 ...- fix for CVE-2014-5355 (#1193939) "krb5: unauthenticated denial of service in recvauth_common() and others"- Update to krb5-1.13.1 - drop patch for CVE_2014_5353_fix_LDAP_misused_policy_name_crash, fixed in krb5-1.13.1 - drop patch for kinit -C loops (MIT/krb5 bug #24xhwX L8_D$O_D^D`D839c736ff2d09511b49dc918c725cd7b6b149441d3c67dbaf8ff43d6df436f9200c72c235c6b597b6751550cb3de3efd190e496f244b23a74ac6d2ec825064053934485832818738200a72dfc4c723186efdbfd82d04690ee48dfe9c6fc8035b0f86d7d0c0a9379fc44b800aed6b66414b5b2b99ca42f4c6799c9b7a27143d23f8dc1ece5fdb2afb11bb8dcc0ce7a07cae606ac18f7010776a83b484769ee1280b81ec8852b6f5bb952073aa04f6589920a3805a187b7a473578d9d23959eda250c9e76391ad07e245f4df95e0507a40f45f877de036eae1c3105a7529e096caa478d6df9644d3e54fb31004f2179a2f0fe99e3790f9b0c409983b1988a08aef42bc9ce1327bd8ffc465c11c2ba4daf523b2c340ca20a463a38694744f2f7f022bbda61825b9f6c3c29846e61574de671eca3b5cf375c4a4232eb23c68f64b25f836b34a8b180467ff0f4ad5a5d78928b9dc77404079871ddd3e1bf25c5045c3ae5dbbfeade9145cb0a58a5e2f8a61109fcb4a2b8071cb63574fe0f41339f3063da0199e80637b8cef7ed041ec84358a46f74b5347668178a986da92c986fc43e6b77b2b9af76ea9a18194995493e89a73619c17c7dc97e80c7c8a9c283ca08a62c5db0a7304725805967583c8890db0a1345504db8df4ab2552691d6e00736f3e55fe7ec031877e714af4b07c373ce2b3b3c803733f5e3d980ff02a81bdf66e4eae7366f9303d5349a4367fca988b0673c4fbf9f3b8bf4f8993c16c2b6be3faa296caa3db48b82cb60ff01d992787f860c84dbea6e295fdb94dff2e9819b7e8d230282f2569d927a85c12b3811996a70251d766cd9b4d958fd679a5fdc203ea2ec78c13e656c82efa34695c021611c6d17eb13deebe0bfc318243bb59764ba2f5c5ce2d593cad9952882e68876bd92de64321c5acde40046673ceac3649db2c6fbb72aef2a8c4ef5229163a91f7fbd97c095e467578dacce5545d167d244abf7ee88a9b569a29e5b51e260263a6554dbedbf521833215b85422386c5032c0366e0cd8d2667de4ffa8ed44abbecc49159f94d74fabb6c1324b1f2cfce313f25c68584821b1748b9ad59715b08886d8f61eed71912d3840dddc368e827edfbdef40aa155454092a72f99d56c0502ec63fd5afa4e85b86c9502f8ad4f1b087afd40967d24a3b01f8046f1a2407d632f8720b505be1e25c3bd6c8225c5b1ddbe1c18ea7b33f88fc44a1d38e85943a5c225747fa9733fd589bc3af7ec8b3d23a156a62a06d15a39c37fa7d14d4a5eab4e2f6698749979480905bfbcff95874aa408e98772338ec9a8c876b02e8e0f6d24f935a057fafb5819e17567c88f49d62108e1e83153931be3ecfe8ea81f68090415a1754f1fff9ab140d061cdd9943ae16c2de43ad796959be96820edb1be9d1818cd80c5e270b8093538d3204e535abdee86b968169c0c16b52732a593ca9c662f75c2ce1e30e513fc3f432235f5818a65bd57fec9e3e193216f13b4c28c3c49f4e593023c55b487e0f1b59ed62b3319f717e3e76420dc2d72b1a8d74a8e4aedb469e6602d10e01b46576a08c5fbac777cba951f24cc1596bf75c4e4fe27b21bfc81a11a054b95cf7bff2227105470aa806f93443182ce7a4accdc9286b9d85475f7380e779e48abf9188b3e553928d61bda6293dd3e0e20c58a64273e1447a7f93af2035754867de8bd129d14cb4f19f153cca52c88be3f71601501cbc9fc28d389ae7789bf3cf8394b7b3a68264ed812f2ccd855001705753254698c0a2991d889e9d8a3cfec34704b040b1020f23789fdfa08c4cb1b238c7f0887332e525f59a93c79a13174364f1eccd889200c11d1114c6f075dde2e76c1fe5e693a1f3721757814b4ff11b2644eb756e2316f6bb30011de182ea92f24ce01e04b5322eecb692c5595717ee187c9b55f912e86d13c243ed99d2e8c7a95a49286b27d55fb97196052c3c0e9232f08a8ce3c5401bc9c0cbeebab451a02bfae5350805ccbfb14970b97e975cbfe7cafdd0a494aa45027623a33a91f1e92902ac372a5b6bcddd24b4d8ddc2d99f894f18e6573b8632a0bb1c165fd0ddf2cf39487e7c1f8f3e61a3b146c3e247a222f4470598cda72dfbdc731f49f888a3be75caa92d97d57e5ca0bfd4da5a30ba503f56fef24d83953013ccd27d6edd08b036909c3338c3843274a84bca865683c7259f97ebd5084829ec9ec82c3c1b5e1a7c29f07562c88f855a1622f663f973f01fc95ecbcfd8c3c883d6e767abd1d42466019c1874ece28662df31d4a3b8feec6d8cb72a43a4eeaf128ce49dfb3bec5ecc95b036cd0d21cb5de59fa0efa8ff94918acc401e9ad5e29c590ea268dc3fdef449cee9b912caf2c7dd863799771756957c648c524c332104c9aad9b7ffe86c441ca4971bb9a1e0e2a1cd5a634318afd9b5e87931f3ae5791e18da1f6314e9479a39f45396badb3ddd4f1fcff338cb8fec1de0d52a660c1a91f884508a5576c6b97f740fdb9ab81ef8aa7cfa4b3272986272150fd445b8effeff986c2097cd88fba880fed1bb856258f00fa66f930bf2cf2fff3b8fb49f675a31a800f9ade01644b61ff2116601ab8e5c2a835f75ee67b431fd484cfd30fedc3f875237c18deedd56dca7b7884f1353bfb24f8578da7870a803374d5e3f98ea6b1ba3277d2d825fb0109fb612922b4f18c09998c73524bed6386ecc6a05d7c17e241956a6ce9af81ded15122c056017a5972bc9de433d7d3f0c5d977df7e45018a08afdd538836d96b7a7f27e4a45e21e0bc21f8ad30fb293e9eda21b0dc502dab28348a3d00eeae320de282214de9257xfXLؤv$* files. * Fixes for genhomedircon and seobject. * Audit message for mass relabel by setfiles.- Update audit mass relabel to only compile in when audit is installed.- Update to required versions - Update translation- Fix shell selection- Add BuildRequires for gettext* Updated fixfiles script for new setfiles location in /sbin.- Update to upstream * Merged more translations from Dan Walsh. * Merged patch to relocate setfiles to /sbin for early relabel when /usr might not be mounted from Dan Walsh. * Merged semanage/seobject patch to preserve fcontext ordering in list. * Merged secon patch from James Antill.- Fix seobject.py to not sort the file_context file. - move setfiles to /sbin- secon man page and getopt fixes. - Enable mass relabel audit, even though it doesn't work.- secon fixes for --self-exec etc. - secon change from level => sensitivity, add clearance. - Add mass relabel AUDIT patch, but disable it until kernel problem solved.- Update to upstream * Merged patch with updates to audit2allow, secon, genhomedircon, and semanage from Dan Walsh.- Fix exception in genhomedircon- Add rhpl dependancy- Add secon man page and prompt options.- Update to upstream * Fixed audit2allow and po Makefiles for DESTDIR= builds. * Merged .po file patch from Dan Walsh. * Merged bug fix for genhomedircon.- Fix exception on bad file_context- Update to upstream * Merged fix warnings patch from Karl MacMillan. * Merged patch from Dan Walsh. This includes audit2allow changes for analysis plugins, internationalization support for several additional programs and added po files, some fixes for semanage, and several cleanups. It also adds a new secon utility.- Fix genhomedircon to catch duplicate homedir problem- Add secon program - Add translations- Fix check for "msg"- Ship avc.py- Add /etc/samba/secrets.tdb to restorecond.conf - Update from upstream * Merged semanage prefix support from Russell Coker. * Added a test to setfiles to check that the spec file is a regular file.- added some missing buildrequires - added Requires: initscripts for /sbin/service- use absolute path /sbin/service- Fix audit2allow to not require ausearch. - Fix man page - Add libflashplayer to restorecond.conf- Update from upstream * Merged audit2allow fixes for refpolicy from Dan Walsh. * Merged fixfiles patch from Dan Walsh. * Merged restorecond daemon from Dan Walsh. * Merged semanage non-MLS fixes from Chris PeBenito. * Merged semanage and semodule man page examples from Thomas Bleher.- Clean up reference policy generation in audit2allow- Add IN_MOVED_TO to catch renames- make restorecond only ignore non directories with lnk > 1- Make audit2allow translate dontaudit as well as allow rules - Update from upstream * Merged semanage labeling prefix patch from Ivan Gyurdiev.- Fix audit2allow to retrieve dontaudit rules- Open file descriptor to make sure file does not change from underneath.- Fixes for restorecond attack via symlinks - Fixes for fixfiles- Restorecon has to handle suspend/resume- Update to upstream- Add restorecond- Remove prereq- Fix audit2allow to generate all rules- Minor fixes to chcat and semanage- Add missing setsebool man page- Change audit2allow to use devel instead of refpolicy- Update from upstream * Merged semanage bug fix patch from Ivan Gyurdiev. * Merged improve bindings patch from Ivan Gyurdiev. * Merged semanage usage patch from Ivan Gyurdiev. * Merged use PyList patch from Ivan Gyurdiev.- Update from upstream * Merged newrole -V/--version support from Glauber de Oliveira Costa. * Merged genhomedircon prefix patch from Dan Walsh. * Merged optionals in base patch from Joshua Brindle.- bump again for double-long bug on ppc(64)- Fix auditing to semanage - Change genhomedircon to use new xXVX|L@c$rovides are not recognized for erase command. (RhBug:1087063)" (Ales Kozumplik) - fix: provides are not recognized for erase command. (RhBug:1087063) (Ales Kozumplik) - test: fix UsageTest test, so it work without dnf is installed on the system PEP8 cleanup (Tim Lauridsen) - cleanup: getSummary() and getUsage() can be dropped entirely now. (Ales Kozumplik) - test: use Command.usage & Command.summary API in unittest (Tim Lauridsen) - show plugin commands in separate block api: add new public Command.usage & Command.summary API cleanup: make Commands (Tim Lauridsen) - tests: move libcomps test to a separate test file. (Ales Kozumplik) - refactor: put DistoSyncCommand into its own file (Tim Lauridsen) - refactor: commands.group: _split_extcmd is a static method. (Ales Kozumplik) - GroupsCommand: make the way comps are searched more robust. (RhBug:1051869) (Ales Kozumplik) - tests: move GroupCommand tests to a more proper place. (Ales Kozumplik) - fix leak: Base.__del__ causes GC-uncollectable circles. (Ales Kozumplik) - gruops: 'list' and similar commands should run without root. (RhBug:1080331) (Ales Kozumplik) - refactor: conf is given to Output on instantiation. (Ales Kozumplik) - remove: Command.done_command_once and Command.hidden. (Ales Kozumplik) - [doc] improve documentation of '--best' (RhBug:1084553) (Ales Kozumplik) - api: Command.base and Command.cli are API attributes. (Ales Kozumplik) - demands: similarly to 78661a4, commands should set the exit success_exit_status directly. (Ales Kozumplik) - demands: commands requiring resolving dymamically need to set the demand now. (Ales Kozumplik) - doc: typo in group doc. (RhBug:1084139) (Ales Kozumplik) - api: Base.resolve() takes allow_erasing. (RhBug:1073859) (Ales Kozumplik) - refactor: OptionParser._checkAbsInstallRoot is static. (Ales Kozumplik) - option_parser: remove base dependency. (Ales Kozumplik) - move: dnf.cli.cli.OptionParser -> dnf.cli.option_parser.OptionParser. (Ales Kozumplik) - doc: 'clean packages' incorrectly mentions we do not delete cached packages. (RhBug:1083767) (Ales Kozumplik) - fix: TypeError in dnf history info (RHBug: #1082230) (Tim Lauridsen) - Start new version: 0.5.0. (Ales Kozumplik) - remove: instance attrs of Base, namely cacheonly. (Ales Kozumplik) - tests: remove: support.MockCli. (Ales Kozumplik) - tests: fix locale independence. (Radek Holy) - cleanups in cli.OptionParser. (Ales Kozumplik) - fix: PendingDeprecationWarning from RPM in gpgKeyCheck(). (Ales Kozumplik) - api: add Cli.demands.root_user (RhBug:1062889) (Ales Kozumplik) - api: add Cli.demands and Command.config() to the API (RhBug:1062884) (Ales Kozumplik) - Integrate DemandSheet into CLI. (Ales Kozumplik) - Command.configure() takes the command arguments like run(). (Ales Kozumplik) - Add dnf.cli.demand.DemandSheet. (Ales Kozumplik) - remove: dead code for deplist, version and check-rpmdb commands. (Ales Kozumplik) - sync with transifex (Jan Silhan) - removed _enc method that did nothing without specspo (Jan Silhan) - fixed local reinstall error (Jan Silhan) - Fix Term.MODE setting under Python 3 in case of incapable tty stdout. (Radek Holy) - tests: move Term tests to better file. (Radek Holy) - refactor: move ReinstallCommand in its own module. (Ales Kozumplik) - rename: yumbase (case insensitive) -> base. (Ales Kozumplik) - fixed py3 error thrown by search command (Jan Silhan) - fixed wrong named variable (Jan Silhan) - fixed local downgrade error (Jan Silhan) - doc: fix Package references that are ambiguous now. (Ales Kozumplik) - fix: resource leak in yum.misc.checksum() under py3. (Ales Kozumplik) - fix: leak: couple of files objects left open. (Ales Kozumplik) - fix PendingDepreaction warning from rpm in _getsysver(). (Ales Kozumplik) - repo: Repo.cachedir is not a list. (Ales Kozumplik) - api: add Base.package_install et al. and Base.add_remote_rpm(). (RhBug:1079519) (Ales Kozumplik) - tests: fix tests broken under foreign locale after 32818b2. (Ales Kozumplik) - refactor: move install, downgrade and upgrade commands into separatxEXLHG$nGGection -fcf-protectioncpioxz2noarch-redhat-linux-gnuXML 1.0 document, ASCII text, with very long linesdirectoryPHP script, UTF-8 Unicode textemptyutf-8c4fdaf0ab5cb76d79807508203fb50631ecc90fcaa47102a3e63da63538610d0?0pw4zOS(Pfa15dc6241a06ac3f63724eee50908976bae28dc7a6cbe096cdb1c0d485fcb4d89e796f3711d256f23810fc619ab73e15b0d495aj{' j{Utrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroox|4XLhr$LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fa/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fil/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/fur/LC_MESSAGES//usr/share/locale/gd/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/kk/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@latin/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/th/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/ur/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man5//usr/share/man/man7//usr/share/man/man8//var/cache/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnuASCII textdirectoryC source, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)(/usr/bin/sqlite3 if bash-completion)(python3-dbus if NetworkManager)utf-852944eac3e6e6d970d881c84164810d39d618405512146911f9dd67093ca4eea?gX3!^P,*%g *%'PdRA~_ u w,%*C%c ~fl&¯X0B&{1NN=ɰl#CoYVsic\=ތ OMMLT%d= )4SDx080N%YމTT;?N#֠4öYTYOBKKCh'f˨`b %Ͽܒ 楇;y-=ؠd*sBuQ|j^So  wۤb4$5S_v9;>귷Tgv}xܷ\X݈$VdpTbN^򡺠Z?k?ߖezN8^ia?}=/FY,V+\l(HAJ;YhIqYV 6v2_ACa8Ur|LenĦcF/ l5x%M\Áy̵ˬ0sjhcUJ>oELkcp4YhDj:3!^P,*%g *%*ӡ{L3x}N-fXno f_!j?@ABCDEFGHIJKLMNOPQ1.0-125.145.1.cpanel1.0-125.145.1.cpanel    ea4-metainfo.jsonREADME.mdpkg-manifest.jsonrecommendationsea-apache24-mod_cpaneleol.jsonea-nginx-brotlioff.jsonea-nginx-gzipoff.jsonea-nginx-http2off.jsonon.jsonea-nginx-njsoff.jsonea-nginx-passengeroff.jsonea-nginx-standaloneoff.jsonea-php54ea-php54-phpea-php54-php-cliimportant.jsonea-php54-php-commonimportant.jsondso.jsoneol.jsonea-php55ea-php55-phpea-php55-php-cliea-php55-php-commonea-php56ea-php56-phpea-php56-php-cliea-php56-php-commonea-php70ea-php70-phpea-php70-php-cliea-php70-php-commonea-php71ea-php71-phpea-php71-php-cliea-php71-php-commonea-php72ea-php72-phpea-php72-php-cliea-php72-php-commonea-php73ea-php73-phpea-php73-php-cliea-php73-php-commonea-php74ea-php74-phpea-php74-php-cliea-php74-php-commonea-php80ea-php80-phpea-php80-php-cliea-php80-php-commonea-php81-phpea-php81-php-cliea-php81-php-commonea-php82-phpea-php82-php-cliea-php82-php-commonea-ruby24-mod_passengereol.jsonea-tomcat85eol.jsontarget-os-pkg-renames.json001-ensure-nobody001-ensure-nobodyea4_repo_uri_osea_convert_php_iniea_current_to_profileea_install_profileea_sync_user_phpini_settingsphpini_directive_links.yamlphpini_directives.yamlcpanel-server-trafficweb/etc/cpanel/ea4//etc/cpanel/ea4/option-flags//etc/cpanel/ea4/profiles//etc/cpanel/ea4/recommendations//etc/cpanel/ea4/recommendations/ea-apache24-mod_cpanel//etc/cpanel/ea4/recommendations/ea-nginx-brotli//etc/cpanel/ea4/recommendations/ea-nginx-gzip//etc/cpanel/ea4/recommendations/ea-nginx-http2//etc/cpanel/ea4/recommendations/ea-nginx-njs//etc/cpanel/ea4/recommendations/ea-nginx-passenger//etc/cpanel/ea4/recommendations/ea-nginx-standalone//etc/cpanel/ea4/recommendations/ea-php54-php-cli//etc/cpanel/ea4/recommendations/ea-php54-php-common//etc/cpanel/ea4/recommendations/ea-php54-php//etc/cpanel/ea4/recommendations/ea-php54//etc/cpanel/ea4/recommendations/ea-ruby24-mod_passenger//etc/cpanel/ea4/recommendations/ea-tomcat85//etc/dnf/universal-hooks/multi_pkgs/pre_transaction/ea-__WILDCARD__//etc/dnf/universal-hooks/multi_pkgs/transaction/ea-__WILDCARD__//etc/yum/vars//usr/local/bin//usr/local/cpanel/whostmgr/etc//var/log//var/log/cpanel-server-traffic/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectionobs://private/EA4-production/CentOS_8/6e14846ea50943f76f8e1d6b0be450c7-ea-cpanel-toolscpioxz2x86_64-redhat-linux-gnux8XLW$$($$$CVE-2014-1947, CVE-2014-2030 (bz#1064098) - Enable %check by Alexander Todorov suggestion - bz#1076671. - Add %{?_smp_mflags} into make install and check (not main compilation).- Drop BR giflib-devel (bz#1039378)- Rebuild for libwebp soname bump- rebuild (openexr)- Use %__isa_bits instead of hardcoding the list of 64-bit architectures.- Update to 6.8.7-0 to fix badurl (http://www.mail-archive.com/devel@lists.fedoraproject.org/msg67796.html)- rebuild (openexr)- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- Update to 6.8.6-3. - Added aarch64 to list of 64bit arches (bz#978339).- Update to 6.8.5-10 upstream version (bz#720285). - By Remi Collet request (bz#969760) enable those features in ImageMagick: --with-lcms2 (instead of --with-lcms): lcms2-devel --with-openexr: OpenEXR-devel --with-webp: libwebp-devel- Enable fftw to do Fourier transforms (add BuildRequires: fftw-devel) - bz#950254 by Søren Sandmann Pedersen request.- Update to 6.8.3-9 (so-naming scheme change to *-6.so) (ml: http://www.mail-archive.com/devel@lists.fedoraproject.org/msg57163.html). - Split out libs subpackage by Remi Collet request (bz#849065).- rebuild (OpenEXR)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- rebuild due to "jpeg8-ABI" feature drop- rebuild against new libjpeg- Update to 6.7.8-9 to fix CVE-2012-3437 (bz#844101, 844103).- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Update to 6.7.7-5 version. Prepare and update in stable Fedora 16 to address security problems (f.e. bz#808159).- Rebuild due libtiff update http://www.mail-archive.com/devel@lists.fedoraproject.org/msg42846.html- Update to 6.7.6.5 to fix security issues: bz#807993, bz#807994, bz#807997, bz#808159, bz#804591, bz#804588- Update by request https://bugzilla.redhat.com/show_bug.cgi?id=755827#c8 - Delete multilib patch as it should be in main sources. - Replace $RPM_BUILD_ROOT by %buildroot- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuild for new libpng- New version 6.7.1-9.- Perl mass rebuild- Perl mass rebuild- Update to 6.7.0-10.- Perl mass rebuild- Perl 5.14 mass rebuild- Add BR liblqr-1-devel (BZ#683159) - Update to new version (BZ#579458) 6.6.8-4- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Add BR OpenEXR-devel to support OpenEXR format (BZ#663705)- New version 6.6.5-10. - Add --enable-hdri switch by request of Petr Vlašic.- Rebuild against new ghostscript in rawhide. - Update to 6.6.4-8 version.- rebuild against new ghostscript- %files: track sonames, so as not to be surprised by future ABI breaks- Update to 6.6.4-1 to fix FBFS BZ#631169.- Add %doc LICENSE as it required new Licensing Guidelines Update ( https://fedoraproject.org/wiki/Packaging:LicensingGuidelines )- Rebuild (to fix downgrade after perl-5.12.0-rebuild tag)- New version 6.6.2-1 (BZ#579458, BZ#565940 - http://www.imagemagick.org/discourse-server/viewtopic.php?f=3&t=16320) - Replace %define by %global- Mass rebuild with perl-5.12.0- Update to 6.6.0-2 (BZ#570766)- Update to 6.5.8-10 (BZ#547806) - Change source tarball from .tar.lzma to .tar.xz folow to upstream.- rebuild against perl 5.10.1- Explude file Generic.ttf from -perl subpackage demos. Demos perfectly work without it, but with bundled font package does not pass QA (Unfortunately no bugreport there, only mail from Nicolas Mailhot)- Update to version 6.5.4-6 - Use lzma-compressed source tarball as sugested by Ville Skyttä (BZ#515319)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- New upstream release 6.5.3-6- update to 6.5.1-2- Fix undefined warning in magick-type.h (#489453) - Do not link PerlMagick against system ImageMagick, but against the just build one- New upstream release 6.4.9-6- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Remove (TM) from description as per new guidelines- Corrected the wrong release and bumped- Rebuild wixXL*$** *.com> 2.13-0.20Jesse Keating 2.13-0.19Karel Zak 2.13-0.17Karel Zak 2.13-0.16Jesse Keating - 2.13-0.15.1Peter Jones 2.13-0.15Jesse Keating - 2.13-0.14.1Steve Dickson 2.13-0.14Karel Zak 2.13-0.13Karel Zak 2.13-0.12Jesse Keating Karel Zak 2.13-0.11.pre6Karel Zak 2.13-0.10.pre5Karel Zak 2.13-0.9.pre5Karel Zak 2.13-0.8.pre5Karel Zak 2.13-0.7.pre5Karel Zak 2.13-0.6.pre5Karel Zak 2.13-0.5.pre4Karel Zak 2.13-0.4.pre4Steve Dickson 2.13-0.3.pre3Karel Zak 2.13-0.3.pre2Karel Zak 2.13-0.2.pre2Karel Zak 2.12p-9.7Karel Zak 2.12p-9.5Jeremy Katz - 2.12p-9.3Karel Zak 2.12p-9.2Karel Zak 2.12p-9Karel Zak 2.12p-8Karel Zak 2.12p-7Steve Dickson 2.12p-5Karel Zak 2.12p-4Elliot Lee 2.12p-3Steve Dickson 2.12p-2Elliot Lee 2.12p-1Elliot Lee 2.12j-1Steve Dickson 2.12a-20Elliot Lee 2.12a-19Steve Dickson 2.12a-18Elliot Lee 2.12a-16Stephen C. Tweedie - 2.12a-15John (J5) Palmieri 2.12a-14Stephen C. Tweedie 2.12a-13Phil Knirsch 2.12a-12Steve Dickson Elliot Lee 2.12a-10Steve Dickson Nalin Dahybhai 2.12a-8Phil Knirsch 2.12a-7Elliot Lee 2.12a-6Steve Dickson Alasdair Kergon Alasdair Kergon Steve Dickson Jindrich Novy Elliot Lee 2.12a-3Elliot Lee Elliot Lee 2.12a-1Dan Walsh 2.12-19Elliot Lee 2.12-18Elliot Lee 2.12-17Elliot Lee 2.12-16Jeremy Katz 2.12-15Dan Walsh 2.12-13Dan Walsh Steve Dickson Steve Dickson Dan Walsh 2.12-5Elliot Lee 2.12-4Dan Walsh 2.12-3Elliot Lee Elliot Lee 2.12-1Steve Dickson 2.12pre-4Elliot Lee 2.12pre-3Dan Walsh 2.12pre-2Elliot Lee 2.12pre-1Dan Walsh 2.11y-35.selDan Walsh 2.11y-34.selElliot Lee 2.11y-34Dan Walsh 2.11y-33Dan Walsh 2.11y-32.selElliot Lee 2.11y-31Dan Walsh 2.11y-31Dan Walsh 2.11y-30.selElliot Lee 2.11y-28Dan Walsh 2.11y-27Dan Walsh 2.11y-26.selElliot Lee 2.11y-25Dan Walsh 2.11y-24Elliot Lee 2.11y-22Elliot Lee 2.11y-20Elliot Lee Elliot Lee 2.11y-17Elliot Lee 2.11y-16Elliot Lee 2.11y-15Matt Wilson 2.11y-14Jeremy Katz 2.11y-13Jeremy Katz 2.11y-12Phil Knirsch 2.11y-11Elliot Lee 2.11y-10Elliot Lee Elx(XmLZ$JZ7I?d  . W  06@T ^ h |  9( 89|: FOG`HtIXY\]^Sbcbdefltuv z, < T}ghCea-php72-php-ioncube1010.4.57.12.7.cpanelv10 Loader for ionCube-encoded PHP filesThe v10 ionCube Loader enables use of ionCube-encoded PHP files running under PHP 7.2.j|hou-2EA4-production / CentOS_8cPanel, Inc.RedistributableDevelopment/Languageshttp://www.ioncube.com/loaders.phplinuxx86_64(*A큤j|j|j|^W_9e56731e5eb9e35754c16fd646742e3fa402f4eb29e2de5ad8b75ac2fe3f02bab0790caadd4788321a770fd9bf34c10126be10121079030df44d730dbfae124071e20644eb4e66b8c32f86c9ebc8bdac575cd196763aa450726253e3cdb8366c5b3417232cfd90fe98471b7aa3c67b8aa427115136226ad24862a82c1468a0f2rootrootrootrootrootrootrootrootrootrootea-php72-php-ioncube10-10.4.5-7.12.7.cpanel.src.rpmconfig(ea-php72-php-ioncube10)ea-php72-ioncubeea-php72-php-ioncube10ea-php72-php-ioncube10(x86-64)scl-package(ea-php72)@@@@@@    config(ea-php72-php-ioncube10)ea-php72-php(api)ea-php72-php(zend-abi)ea-php72-php-cliea-php72-runtimelibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.4)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)10.4.5-7.12.7.cpanel20170718-6420170718-643.0.4-14.6.0-14.0-15.2-1 ea-php72-ioncubeea-php72-ioncubeea-php72-php-ioncubeea-php72-php-ioncube5ea-php72-php-ioncube610114.14.3g`@d,@b5@a@a@_@_Í@_/@_d@_'@^)@^K]@]e@\eX@\\[`O@[?YZmZ@ZH@Z8@Z2gYY@YYDan Muey - 10.4.5-7Julian Brown - 10.4.5-6Julian Brown - 10.4.5-5Dan Muey - 10.4.5-4Julian Brown - 10.4.5-3Daniel Muey - 10.4.5-2Cory McIntire - 10.4.5-1Tim Mullin - 10.4.4-1Tim Mullin - 10.4.3-1Tim Mullin - 10.4.1-1Tim Mullin - 10.4.0-1Tim Mullin - 10.3.9-2Tim Mullin - 10.3.9-1Tim Mullin - 10.3.8-1Cory McIntire - 10.3.2-2Cory McIntire - 10.3.2-1Tim Mullin - 10.2.4-1Tim Mullin - 10.2.2-1Daniel Muey - 10.2.0-2Cory McIntire - 10.2.0-1Daniel Muey - 10.1.1-1Cory McIntire - 10.1.0-2Cory McIntire - 10.1.0-1Dan Muey - 10.0.3-2Dan Muey - 10.0.3-1Dan Muey - 10.0.0-1- ZC-12441: Address deb’s versioned-dir situation- ZC-10047: Do not build on Ubuntu 22- ZC-10221: ioncube dropped support for 10, remove find-latest-versionxXL0K;$;;Mf?ad   8 <@JTZ Z   T   V     $ D  " L""(89h:.?>V?V@VGVHW IWXWYW\W]X8^Yb[d\ie\nf\ql\st\u\v]\ w`,x`y`axa|aaaa6d d"6 fXffffgfhfCstunnel5.712.el8_10A TLS-encrypting socket wrapperStunnel is a socket wrapper which can provide TLS/SSL (Transport Layer Security/Secure Sockets Layer) support to ordinary applications. For example, it can be used in conjunction with imapd to create a TLS secure IMAP server.f"x64-builder01.almalinux.org_>AlmaLinuxAlmaLinuxGPLv2AlmaLinux Packaging Team Applications/Internethttps://www.stunnel.org/linuxx86_64/sbin/ldconfig if [ $1 -eq 1 ] ; then # Initial installation systemctl --no-reload preset stunnel.service &>/dev/null || : fi if [ $1 -eq 0 ] ; then # Package removal, not upgrade systemctl --no-reload disable --now stunnel.service &>/dev/null || : fi/sbin/ldconfig if [ $1 -ge 1 ] ; then # Package upgrade, not uninstall systemctl try-restart stunnel.service &>/dev/null || : fih+x9 _a{FCLIAAAAA큤A큤f"f"f"f"f"f"f"f"f"f"f"f"f"`^`^f"f"f"f"f"`^f"cͥC`^f"f"91996709fe53151ef2b9914bc928cef6ff29c1b42aa22a7f518a43777cdad2dcf778fd73f96e7ad434423facc858f3a864f33d989fdd64e4b5b0d3a0a814607a8e86d44d83d1722371393ff3943e1779111b033da5e89ad1e564d2e5e3be0d8966b333e2c7df01c8a0c2d0a50c0c10d72bf5d107d87ea6b89bf14ef7285724bbbf7abf16c5edbcb669c9b341b340f08190444d54dd11bba668fd65435c79526ad00fa133b7e7b241c6d973a70a2ae24d38afed6dfc06014aeff117f4cf8e0163677cb3f1256f812fb9b2877efd0e0ffdead757c0a1dc7123c175d140104aab9cac880df2d158eca8a1ca5de0c3f4edede5ed7cdc3b6b3167ad97466cfe280e88d4953253db8cfd8ea1449911ad32723bf7230a8c8edfb394c83b02feeb25f84be9bb26d7e8fbe978d34168ecbb22205179345cfc1874b00c87de17bcb287d9a995379ab5046177833b717c4c832748d31ec314f469c67e9fe4b160876ca930664d06bccd910b1c8d89ed560fb8375e5e0b220e368a51ce6714e0bc2cd67dc6e43f7d0a05bd73114a8b52f50288234131459386e7788b6a20d34027a0bf9a3a897baa178b520e8571ca9f211a255371661c2222ce083836568947100a9b7586dfc172514e95e387eb4c77cdfbb55b635bf96e2dfcb85d785d993f64c40c4f89c462f171d4d8b6726df61f18a6bbc0a70f79c4bc2134d837d35c81fc6289a2d84dee806205bead0182ecd9f4a0fe9889ee30e7ebf7b431767c2cae7533428042cd819f5fe8635fff2f8faa4236fb943b2630e360ea816fb1179cb11698c0578919../../../../usr/lib64/stunnel/libstunnel.so../../../../usr/bin/stunnelrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrooxXL(L$L( ?0?d & 2  $ )5JPX\ ^ ` d  Hh1(Y8`9t:jG(H,I0X4Y@\`]d^lbdefltuv <@F  $g(h,Ccpanel-perl-542-parallel-subs0.0021.cp130~el8CPAN module - Simple way to run subs in parallel and process their return value in perlCpanel build perl module 'Parallel::Subs'Simple way to run subs in parallel and process their return value in perlh$bh-centos-8.dev.cpanel.net(perlcpanel/perlhttps://metacpan.orglinuxnoarch(ށ$Zlfd53824f65797cc4dd40b1a54674c1a6d98c6c37c37f9522c1fe74176903b68crootrootcpanel-perl-542-parallel-subs-0.002-1.cp130~el8.src.rpmcpanel-perl(Parallel::Subs)cpanel-perl-542-parallel-subscpanel-perl-parallel-subs     cpanel-perl-542cpanel-perl-542-parallel-forkmanagercpanel-perl-542-sys-inforpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@ZZH@Busy Camels - 0.002-1.cp130Busy Camels - 0.002-1.cp108Busy Camels - 0.002-1.cp1198Nicolas Rochelemagne - 0.002-1.cp1170Todd Rinaldo - 0.001-1.cp1170- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Parallel-Subs 0.002- Update from upstream: Parallel-Subs 0.0010.0020.002-1.cp130~el80.002Subs.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Parallel/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8f4f1e7034154b30cb622806f0dcea549520af1c8afee88258be6fcb06c08fdb4?\Ц.Tn5g!x fcbea02b84fa00b4ce905f76c3acd804a3240f9431668c84989ab5685c65429db321fc3733261b3b174f9e8933e9080fc3bb74cdj{* j{Urootrootrootrootrootcpanel-php83-net-ftp-1.4.1-2.cp118~el8.src.rpmcpanel-php83-net-ftp     /bin/sh/bin/shcpanel-php83cpanel-php83cpanel-php83rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3g$_l@U.@N@H1kGnMG]*@GW@CBU BK@Andy Baugh - 1.4.1-2.cp118~el8Todd Rinaldo - 1.4.1-1.cp118Todd Rinaldo - 1.4.0-1.cp118Todd Rinaldo - 1.4.0.3-1.cp118Todd Rinaldo - 1.4.0.2-1.cp118Todd Rinaldo - 1.4.0.1-1.cp118Todd Rinaldo - 1.3.4-1.cp118Todd Rinaldo - 1.3.3-1.cp118Todd Rinaldo 4Ϭ,ЅەS:4:YM f W{0 &ink7A'Y7Dʞ#-EٮߡFUo/=%\jB\)2W|+FO3riUrc zcقvmbB?˴qoWxVȣ>@E Xcvy ,mOmɂWnq-oۤlVhzm@:Oڲ!A5>"C<k 59?V@m@3]ܭ$GwYXd!72496c1c9b965f5474903ea1c33b156735df73c0aa18ff915a651eeadb6a62c9129eb6d097e542cc301e7fc02e78632d8e6d94e2j{xzxpXPL>$ >>>edoraproject.org> 17.2.2-1Peter Robinson 17.2.1-1Peter Robinson 17.2.0-2Peter Robinson 17.2.0-1Peter Robinson 17.2.0-0.3.rc6Peter Robinson 17.2.0-0.2.rc5Peter Robinson 17.2.0-0.1.rc4Fedora Release Engineering - 17.1.5-1.2Fedora Release Engineering - 17.1.5-1.1Peter Robinson 7.1.5-1Adam Jackson Peter Robinson 7.1.4-1Peter Robinson 7.1.3-2Peter Robinson 7.1.3-1Peter Robinson 7.1.2-2Peter Robinson 7.1.2-1Adam Jackson - 17.1.1-2Peter Robinson 17.1.1-1Dave Airlie - 17.1.0-1Peter Robinson 17.1.0-0.4.rc4Peter Robinson 17.1.0-0.3.rc2Peter Robinson 17.1.0-0.2.rc2Igor Gnatenko - 17.1.0-0.1.rc1Igor Gnatenko - 17.0.3-1Igor Gnatenko - 17.0.2-2Peter Robinson 17.0.2-1Hans de Goede - 17.0.1-3Peter Robinson 17.0.1-2Igor Gnatenko - 17.0.1-1Peter Robinson 17.0.0-1Peter Robinson 17.0.0-0.6.rc3Hans de Goede - 17.0.0-0.5.rc2Hans de Goede - 17.0.0-0.4.rc2Peter Robinson 17.0.0-0.3.rc2Peter Robinson 17.0.0-0.2.rc1Igor Gnatenko - 17.0.0-0.rc1Hans de Goede - 13.0.3-3Igor Gnatenko - 13.0.3-2Peter Robinson 13.0.3-1Igor Gnatenko - 13.0.2-2Peter Robinson 13.0.2-1Peter Robinson 13.0.1-1Peter Robinson 13.0.0-3Peter Robinson 13.0.0-2Peter Robinson 13.0.0-1Dave Airlie - 13.0.0-0.3.rc2Peter Robinson 13.0.0-0.2.rc2Igor Gnatenko - 13.0.0-0.1.rc1Hans de Goede - 12.0.3-2Peter Robinson 12.0.3-1Peter Robinson 12.0.2-1Hans de Goede - 12.0.1-7Adam Jackson - 12.0.1-6Igor Gnatenko - 12.0.1-5Igor Gnatenko - 12.0.1-4Igor Gnatenko - 12.0.1-3Orion Poplawski - 12.0.1-2Igor Gnatenko - 12.0.1-1Igor Gnatenko - 12.0.0-1Igor Gnatenko - 12.0.0-0.3.rc4Adam Jackson - 12.0.0-0.3.rc3Igor Gnatenko - 12.0.0-0.2.rc3Dominik Mierzejewski - 12.0.0-0.2.rc2Igor Gnatenko - 12.0.0-0.1.rc2Igor Gnatenko - 12.0.0-0.1.rc1Igor Gnatenko - 11.3.0-0.4.gitcbcd7b6Igor Gnatenko - 11.3.0-0.3.git171a570Björn Esser - 11.3.0-0.2.gitea2bff1Igor Gnatenko - 11.3.0-0.1.gitea2bff1Igor Gnatenko - 11.2.0-0.1.rc3.20160320Dave Airlie 11.2.0-0.devel.11Dave Airlie 11.2.0-0.devel.10Adam Jackson 11.2.0-0.devel.9Fedora Release Engineering - 11.2.0-0.devel.8.24ea81a.1Adam Jackson 11.2.0-0.devel.8Igor Gnatenko xXLH5$?5 ??d"( 4 z  *08< > @ D  0 `  (89:G|HIXY\]^bdKePfSlUtputvx 1tx|ghCcpanel-perl-542-file-slurp-tiny0.0041.cp130~el8CPAN module - A simple, sane and efficient file slurper [DISCOURAGED]Cpanel build perl module 'File::Slurp::Tiny'A simple, sane and efficient file slurper [DISCOURAGED]h%bh-centos-8.dev.cpanel.netperlcpanel/perlhttps://metacpan.orglinuxnoarch$Us393a0de61a40270a5081f337898acd97e4334b67f432aaf7ee2b8fb207eccc53rootrootcpanel-perl-542-file-slurp-tiny-0.004-1.cp130~el8.src.rpmcpanel-perl(File::Slurp::Tiny)cpanel-perl-542-file-slurp-tinycpanel-perl-file-slurp-tiny      cpanel-perl-542cpanel-perl-542-carpcpanel-perl-542-exportercpanel-perl-542-file-spec-functionscpanel-perl-542-filehandlecpanel-perl-542-strictcpanel-perl-542-warningsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)5.573.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@V<@S>Busy Camels - 0.004-1.cp130Busy Camels - 0.004-1.cp108Busy Camels - 0.004-1.cp1198Todd Rinaldo - 0.004-1.cp1156Todd Rinaldo - 0.003-1.cp1146- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: File-Slurp-Tiny 0.004- Update from upstream: File-Slurp-Tiny 0.0030.0040.004-1.cp130~el80.004Tiny.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/File/Slurp/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-80bd9694ee9875d81a19bfb8d9cd431cc878c1f0fc06bea488d922f1849fac2d9?D_*;$d0616173f31d5e7f1bafd997b8f02955173597d0722d00c2cd77fc3092684853cf5c9243d825728ea889dba337dc7b3c2579a889j{j{Uh0 oQT_Cd /Y.bS5eZCpp:VLNkNO +}fCN~wBN4y0-INJXN{t:`CE5Nv9)|3=OT F%r87MNl=9\;@Oc02N5X%gT7<RJNd0u>Ml@NdFO2HS\jKBp;%OTh9zOvZXI23FI<SZB#t  =]/+!Ct0:Sq3F[NJ%- G~@*0rGN-IvNj>H Xb[D2<JfO{<PEHNguX>BNF,@s  fE9Ny;e[؈x`X:L:hr38$#384828 - 7.2.34-7Travis Holloway - 7.2.34-6Cory McIntire - 7.2.34-5Julian Brown - 7.2.34-4Daniel Muey - 7.2.34-3Tim Mullin - 7.2.34-2Cory McIntire - 7.2.34-1Tim Mullin - 7.2.33-2Cory McIntire - 7.2.33-1Tim Mullin - 7.2.32-2Cory McIntire - 7.2.32-1Julian Brown - 7.2.31-3Tim Mullin - 7.2.31-2Cory McIntire - 7.2.31-1Cory McIntire - 7.2.30-1Tim Mullin - 7.2.29-2Cory McIntire - 7.2.29-1Julian Brown - 7.2.28-2Cory McIntire - 7.2.28-1Tim Mullin - 7.2.27-2Cory McIntire - 7.2.27-1Daniel Muey - 7.2.26-2Cory McIntire - 7.2.26-1Tim Mullin - 7.2.25-2Cory McIntire - 7.2.25-1Cory McIntire - 7.2.24-1Cory McIntire - 7.2.23-1Tim Mullin - 7.2.22-2Cory McIntire - 7.2.22-1Cory McIntire - 7.2.21-1Cory McIntire - 7.2.20-3Cory McIntire - 7.2.20-2Cory McIntire - 7.2.20-1Tim Mullin - 7.2.19-2Cory McIntire - 7.2.19-1Julian Brown - 7.2.18-2Cory McIntire - 7.2.18-1Daniel Muey - 7.2.17-4Tim Mullin - 7.2.17-3Tim Mullin - 7.2.17-2Cory McIntire - 7.2.17-1Cory McIntire - 7.2.16-2Cory McIntire - 7.2.16-1Cory McIntire - 7.2.15-1Tim Mullin - 7.2.14-3Cory McIntire - 7.2.14-2Cory McIntire - 7.2.14-1Cory McIntire - 7.2.13-1Cory McIntire - 7.2.12-1Tim Mullin - 7.2.11-2Cory McIntire - 7.2.11-1Cory McIntire - 7.2.10-1Cory McIntire - 7.2.9-1Tim Mullin - 7.2.8-2Cory McIntire - 7.2.8-1Cory McIntire - 7.2.7-1Rishwanth Yeddula - 7.2.6-2Cory McIntire - 7.2.6-1Cory McIntire - 7.2.5-1Rishwanth Yeddula - 7.2.4-3Rishwanth Yeddula - 7.2.4-2Daniel Muey - 7.2.4-1Cory McIntire - 7.2.3-3Daniel Muey - 7.2.3-2Daniel Muey - 7.2.3-1Daniel Muey - 7.2.2-1 - 7.2.1-5 - 7.2.1-4Cory McIntire - 7.2.1-3 - 7.2.1-2Jacob Perkins - 7.2.1-1 - 7.2.0-13 - 7.2.0-12 - 7.2.0-11.RC6 - 7.2.0-10.RC5Jacob Perkins - 7.2.0-9.RC5Dan Muey - 7.2.0-8.RC3 - 7.2.0-7.RC3Tim Mullin - 7.2.0-6.RC3Dan Muey - - 7.2.0-5.RC3 - 7.2.0-4.RC3 - 7.2.0-3.RC1Dan Muey - 7.2.0-2.beta3Dan Muey - 7.2.0-1.beta3- EA4-173: Mark ea-scl-php72 as EOL- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- EA-11821: Patch to build with the latest ea-libxml2- ZC-10873: Do not build on Ubuntu 22- EA-10532: Update litespeed to 8.0.1- EA-9013: Disable %check section- EA-9625: Update litespeed to 7.9- ZC-8005: Replace ea-openssl11 with system openssl on C8- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9338: Update scl-php72 from v7.2.33 to v7.2.34- EA-9281: Update litespeed from upstream to 7.8- EA-9222: Update scl-php72 from v7.2.32xnX LOB$_OBt ?|?d$ 0 g     ] `din $ " (M8T9l:GtHxI|XY\]^bd?eDfGlItduhvl %hlpgthxCcpanel-perl-542-sub-install0.9291.cp130~el8CPAN module - install subroutines into packages easilyCpanel build perl module 'Sub::Install'install subroutines into packages easilyh,bh-centos-8.dev.cpanel.net3perlcpanel/perlhttps://metacpan.orglinuxnoarch3$cu795ea20953521a3f3835aa2aa9aa4ab97b4d439a7225784eeb3b201f80490584rootrootcpanel-perl-542-sub-install-0.929-1.cp130~el8.src.rpmcpanel-perl(Sub::Install)cpanel-perl-542-sub-installcpanel-perl-sub-install     cpanel-perl-542cpanel-perl-542-bcpanel-perl-542-carpcpanel-perl-542-scalar-utilcpanel-perl-542-strictcpanel-perl-542-warningsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h@b@`-@V<@S>Q+R@Todd Rinaldo - 0.929-1.cp130Busy Camels - 0.928-1.cp108Busy Camels - 0.928-1.cp1198Todd Rinaldo - 0.928-1.cp1156Todd Rinaldo - 0.927-1.cp1146Todd Rinaldo - 0.926-1.cp1136- Update from upstream: Sub-Install 0.929- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Sub-Install 0.928- Update from upstream: Sub-Install 0.927- Update from upstream: Sub-Install 0.9260.9290.929-1.cp130~el80.929Install.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Sub/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-8da87dd5b06e2f34fa5d2a9b2b06930bcc06351bfb80d8923573a1cc2e7501f97?LϡI$J-Q"383d9c4c3a4be3037844f85b70da2a1e8b46c6f2420cdcf2f07207433cbe07035cd7b62d7da8b6dfb3aba870672eb1a7cceceee4j{Y5j{Uce394307dfac4334887387779b281e6b09ad2cc0b07560bb4ec7840bdeefa3ef4f7bf6c3a102489b08645db38b2879876f46f591f13bd22deabfd563af45fe3c8efff35e206829a4c21ca23c901f7304c6163426ed7bda035313a92395d52726c52a7f469ccd48ae0ff69389edbf0a0f4b269661dd1fb2f6189720a910d092e8f9cd24a75d594842ec3b77106fae991eb7ea3ad88a30e26822b94e7f2f72fb273d100328238822f09059cc45e6a3ba12d1c8e5a7acf9dd8bf2684ab220d7b94fdf06a43838129981de9c5752898dbfa4d371f8d0f6f9478e0bd641c780c784a267c795023bff616e3b25ec95eb94604e967da5a95e89f85ba2e53be0ee49bcfbfe663838c5d74cd7289f376a084b1c8b0036b46e458c9d06ab266a0c74e4cd348d87dcf5ecad35c0840d15508783cdae28c2a94429ac6889d055716234afddfeb36d86a489b59c25c49a18562cf32272bdc47e45ace79b3532aff1abe01ac1eceadd38a4bac8e79edf7d4daf2d5fd74a25767230c9e55caca1e5d2a39a790e6de4a8d6471f80185ed408fc33785151b521428e0e2da6a33c18dd0446b2cb5bd79b3b87fcd42d1febb8855f6643b0a983ee79exP^XL{N$hNN3.08013.08013.08013.08013.08013.08013.0801-1.cp130~el83.08013.08013.08013.08013.08013.08013.08013.08013.08013.08013.0801Descriptive.pmFull.pmSmoother.pmExponential.pmWeightedexponential.pmSparse.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Statistics//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Statistics/Descriptive//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Statistics/Descriptive/Smoother/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-874e3d3f58deffded38bef4858ae3314b61df056162393a00a8f092db8ac0b9ea?Qi2 |2300ddb9aa9c9e0f41bb567f7529392eab16e70548a3da4e82bb5d66f113ef2985ffa817e46f7c3f4a141f7dcd34998e56ff4b65j{j{U.netɄMITHTML/JShttps://github.com/leocaseiro/angular-chosenlinuxnoarchI{ Ck% 9 n0U&UVPe%A큤A큤A큤A큤A큤A큤A큤A큤bVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVdc2ed6ee40bd259fbf846aec6ff0efd932a31c36b5410e3ced93fd994da96b006cc06775944804a18ee1d0192c9fe875106dcda42b3c815f9e972dd2193f46571a507611a700dacd2cc62a997fd9befe079d2b79d4465462d1b54fafde3e2694e7a19ae420a667456e4ee2fb4a237b416de9e668d6ff8cc4525b8eacf64e1744c73cf45cea51fb4c747ea782f0be90b6e77153d3b781e134fcea232ec78280c865f38d625597707a5f01cb728dae5dda2434754aee6d2ef0d53e52cf19afe7531e6554d3a92eb6fa41e6d1b20e847815cee67e24b57d4b0832720af99006cb2d94970fdf80aa4e4d5ec795413cc8b083dd7946bee7594dc672f3479aeed18276346642620ccdf4ee9b17131ffdc31ff00e1a3b3659abed7a19904b73bcedf562dd177922b55068c0a5a90773c80716ccdf30e89c7419e992c6c7c05f2cbdd04f8113691d02bb1049731ef053b50dcb0aa6df8340330901db0f5dce1a9497a8407ac3cb8162fe14de13c3bb22de67f5383ccc69314712286f87e72640c81fa33943ec10bb56dce16d984de68e24bfa42b9ef4420fbf37a221e0b6bd8f79d4b710182df58a0a82ae6c210af67b9f6ea27eba34319fa5fed27a0ec3ca83fe58ec7a58886711cacea323f8344d8fa146f72537cc7c342aea3618457b2880a48b8e6fe79e3942d8b58c787a7c01d2a621de858e38f0f28fad81288db428b11d99c96517483809354c75d31470348f74411a5b42cf20da1d185739139201b1fc01041cd5029475202d04dc84965ecfbb99901c668935c415eb218238710b5ea09bb09c58ecaba478e94169735d45b29b1a696517d296457a1162ca8bb0b011b05356a5b7995ee1303b98e1fa5ee2aca609ded22513007b0f6d7c173378b75602a7bc7a5e3ed5ec6cf9156bb2a0a6a7b2ee5e0208e9996c78ff06b77ca8cd949a9f1baaa43b710fb2a9336e1e6a07308b7260b78dedf1eebe412ef4f7196820a2da57bd419eb4b098db42025f068cdfede5478896322de06289afea6383a6f92a11cdf47e3b1d44d4573162b94a74b8c59967ea5280de849422b1023883b813ac92941a2acd0592a361d1706938d8d2f8eec5c944f158227483a7db59c0eea6801249d8ac6c6a7499e326279d9132f8a58b71b45b1a5acd7a877ce1f75c8be4e474f9508a080186cfaa4f9d5e6788566e2ad3aa23b96e3ef7e395a98a0766437db68af7cb8baf98bc18cdff822f68836d32abb4a952019bd222b70f0ba47449700849c3187e750b12cdced00ccb03ec4ab67c2e32cbb2c87552a7fa5036c7b874630fd1f2806da702437aa09c86ab51d2e477ea32f7096881075bf1ec8e51bd1563edd6af30c0c358fab684c6c43b2e8dbf76d881e2238873397284657864e8640d36c4b13f8296cdf6c483840ce9ded0c01beb7d9bf255684b47cd9cc7c14538fa8d81de6bdd175c66a48cbf1ace0a7ce30f6158fda2bb335f98aff8101a5f67105ae4xqxMXL99$)99:9Jp? \d  * Ept , : H d + \x0 \ r (89:G0HLIhXpYx\]^;bd e $f 'l )t Du `v |w x y     X l p6   6 X\dghhlCgtk-update-icon-cache3.22.3012.el8_10Icon theme caching utilityGTK+ can use the cache files created by gtk-update-icon-cache to avoid a lot of system call and disk seek overhead when the application starts. Since the format of the cache files allows them to be mmap()ed shared between multiple applications, the overall memory consumption is reduced as well.f x64-builder02.almalinux.orgAlmaLinuxAlmaLinuxLGPLv2+AlmaLinux Packaging Team Unspecifiedhttp://www.gtk.orglinuxx86_64 )c'AAA큤f f f f f X Z8e2a6fa762ce5b49a9933c2d25dfde75aa40c0b065335ace98c680a86465a6a8b7993225104d90ddd8024fd838faf300bea5e83d91203eab98e29512acebd69cc398f27f229d1d12abfebfcc190509235dc5a4601e9dc9679d6cb848097fe4d0../../../../usr/bin/gtk-update-icon-cacherootrootrootrootrootrootrootrootrootrootrootrootrootrootgtk3-3.22.30-12.el8_10.src.rpmgtk-update-icon-cachegtk-update-icon-cache(x86-64)@@@@@@    @libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-1gtk22.24.294.14.3fwMatthias Clasen - 3.22.30-12- Stop loading modules from cwd (CVE-2024-6655) - Resolves: RHEL-469883.22.30-12.el8_103.22.30-12.el8_10gtk-update-icon-cache.build-id8cd980c3129247dfb62ebf15702c58d2a589a178gtk-update-icon-cacheCOPYINGgtk-update-icon-cache.1.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/8c//usr/share/licenses//usr/share/licenses/gtk-update-icon-cache//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8cd980c3129247dfb62ebf15702c58d2a589a178, strippeddirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)RRRRRRR utf-8d9ea25960d134fdcb7db2fe26e87fabc885558bbx@=X L(9D;$;;GC??d  A<@\`jtx  8 X  h 8 4   4( Z8 dG9 G:GG9H9HI9X9Y9\9]: ^: b;d<e<f<l<t=u=Pv=w>x?y?@??????A A ChCCCCgChCCpcre210.323.el8_6Perl-compatible regular expression libraryPCRE2 is a re-working of the original PCRE (Perl-compatible regular expression) library to provide an entirely new API. PCRE2 is written in C, and it has its own API. There are three sets of functions, one for the 8-bit library, which processes strings of bytes, one for the 16-bit library, which processes strings of 16-bit values, and one for the 32-bit library, which processes strings of 32-bit values. There are no C++ wrappers. This package provides support for strings in 8-bit and UTF-8 encodings. Install pcre2-utf16 or pcre2-utf32 packages for the other ones. The distribution does contain a set of C wrapper functions for the 8-bit library that are based on the POSIX regular expression API (see the pcre2posix man page). These can be found in a library called libpcre2posix. Note that this just provides a POSIX calling interface to PCRE2; the regular expressions themselves still follow Perl syntax and semantics. The POSIX API is restricted, and does not give full access to all of PCRE2's facilities.bKx64-builder01.almalinux.org fAlmaLinuxAlmaLinuxBSDAlmaLinux Packaging Team Unspecifiedhttp://www.pcre.org/linuxx86_64-)JH-WG%&a AAAA큤A큤bKbKbKbKbKbKbKbKbKbKZZ4[3[DbKV[516f4c9d9b415b565a9bbea79acbeb87333557f952346fbc69c3c80388b95e474ffe030ee695284af38152f6831077b589c1a715ec49d43efce5ff508f956f0edc5a9ead0af68d7c8b8e1030d8b19d2cef289e1aafe9d6efdc90e9b13afd0d680d4909d0c9f30fbd4891ad195dc13f1f01eb0feefc2506c69019732dd963a36d35cbc0c80ce2c158513ac586ce3f66cf4f9799273fda80ab1bffb68936dbff9399272c55f3dcfa07a8a7e15a5c1a33096e4727de74241d65fa049fccfdd59507c4a8b89cd38d6a7501d5b11a472fa15e71a051b66d6331c6cda364101389d6ee../../../../usr/lib64/libpcre2-posix.so.2.0.1../../../../usr/lib64/libpcre2-8.so.0.7.1libpcre2-8.so.0.7.1libpcre2-posix.so.2.0.1rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpcre2-10.32-3.el8_6.src.rpmbundled(sljit)libpcre2-8.so.0()(64bit)libpcre2-posix.so.2()(64bit)pcre2pcre2(x86-64)@@@@@@@@@    @libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpcre2-8.so.0()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3b~H@\\@\ x,XL' *$ * * *@redhat.com>Bill Nottingham Michael K. Johnson Jakub Jelinek Jakub Jelinek Bill Nottingham Bill Nottingham Cristian Gafton Preston Brown Michael K. Johnson Jeff Johnson Jeff Johnson Bill Nottingham Peter Jones, Christian 'Dr. Disk' Hechelmann Jeff Johnson Jeff Johnson Jeff Johnson Jeff Johnson Jeff Johnson Jeff Johnson Jeff Johnson Michael K. Johnson Cristian Gafton Jeff Johnson Matt Wilson Cristian Gafton Jeff Johnson Jakub Jelinek Matt Wilson Matt Wilson Erik Troan Cristian Gafton Cristian Gafton Michael Johnson Michael K. Johnson Jeff Johnson Cristian Gafton Erik Troan Cristian Gafton Jeff Johnson Cristian Gafton Cristian Gafton Bill Nottingham Erik Troan Erik Troan Erik Troan Jeff Johnson Cristian Gafton Jeff Johnson Jeff Johnson Jeff Johnson Jeff Johnson David S. Miller Jeff Johnson Prospector System Cristian Gafton Erik Troan Cristian Gafton Mike Wangsmo Cristian Gafton Michael Fulbright Michael Fulbright Erik Troan Michael K. Johnson Cristian Gafton Erik Troan Erik Troan Erik Troan Michael K. Johnson Michael K. Johnson Michael K. Johnson - fix RHEL-134296 - libblkid: use snprintf() instead of sprintf() - fix RHEL-133946 - login-utils: fix setpwnam() buffer use [CVE-2025-14104]- fix RHEL-117686 - lslogins: use sd_journal_get_data() in proper way- fix RHEL-13741 - lscpu: avoid EBUSY on cpuinfo_max_freq - fix RHEL-18451 - logger: initialize socket credentials control union - fix RHEL-16070 - util-linux: issues in libblkid - fix RHEL-6274 - lslogins incorrect account expiration field- increment release number- fix RHEL-13741 - lscpu: avoid EBUSY on cpuinfo_max_freq- fix #2117355 - Add additional documentation for fstab - fix #2184728 - libuuid - downport cache related patch - fix #2188894 - The swapon man page of -p(priority) option shows incorrect. - fix #2227097 - wall(1) fail when trying to use seat0- fix #2180413 - Backport hint about systemd daemon-reload- improve #2160321 - [last] ut->ut_user is not null terminated- fix #2121699 - fstrim -av fails to trim root filesystem on Red Hat Coreos - fix #2142496 - update upstream tests - fix #2149394 - umount outputs inaccurate error message when umount() fails with EACCES - fix #2159544 - lslogins "Password is locked" status changed in util-linux-2.32.1-38 - fix #2160321 - [last] ut->ut_user is not null terminated- fix #2141969 - Add --cont-clock feature for libuuid and uuidd- improve tmpfiles.d use in spec file (related to #2059241)- update atari partition tests (related to #2060030)- fix #2060030 - Please backport patches for atari partition detection to RHEL 8 - fix #2069187 - Internal testsuite for lscpu failed on aarch64 - fix #2093166 - lslogins reports incorrect "Password is locked" status - fix #205924x0XILT$%TTTd in user - firewall/server/firewalld: Make getXSettings and getLogDenied CONFIG_INFO - Update AppData configuration file. - tests/firewalld_rich.py: Use new import structure and FirewallClient classes - tests/firewalld_direct.py: Use new import structure - tests: firewalld_direct: Fix assert to check for True instead of False - tests: firewalld_config: Fix expected value when querying the zone target - tests: firewalld_config: Use real nf_conntrack modules - firewalld.spec: Added comment about make call for %build - firewall-config: Use also width_request and height_request with default size - Updated firewall-config screenshot - firewall-cmd: Fixed typo in help output (RHBZ#1367171) - test-suite: Ignore stderr to get default zone also for missing firewalld.conf - firewall.core.logger: Warnings should be printed to stderr per default - firewall.core.fw_nm: Ignore NetworkManager if NM.Client connect fails - firewall-cmd, firewallctl: Gracefully fail if SystemBus can not be aquired - firewall.client: Generate new DBUS_ERROR if SystemBus can not be aquired - test-suite: Do not fail on ALREADY_ENABLED --add-destination tests - firewall.command: ALREADY_ENABLED, NOT_ENABLED, ZONE_ALREADY_SET are warnings - doc/xml/firewalld.dbus.xml: Removed undefined reference - doc/xml/transform-html.xsl.in: Fixed references in the document - doc/xml/firewalld.{dbus,zone}.xml: Embed programlisting in para - doc/xml/transform-html.xsl.in: Enhanced html formatting closer to the man page - firewall: core: fw_nm: Instantiate the NM client only once - firewall/core/io/*.py: Do not traceback on a general sax parsing issue - firewall-offline-cmd: Fix --{add,remove}-entries-from-file - firewall-cmd: Add missing action to fix --{add,remove}-entries-from-file - firewall.core.prog: Do not output stderr, but return it in the error case - firewall.core.io.ifcfg.py: Fix ifcfg file reader and writer (RHBZ#1362171) - config/firewall.service.in: use KillMode=mixed - config/firewalld.service.in: use network-pre.target - firewall-config: Add missing gettext.textdomain call to fix translations - Add UDP to transmission-client.xml service - tests/firewall-[offline-]cmd_test.sh: Hide errors and warnings - firewall.client: Fix ALREADY_ENABLED errors in icmptype destination calls - firewall.client: Fix NOT_ENABLED errors in icmptype destination calls - firewall.client: Use {ALREADY,NOT}_ENABLED errors in icmptype destination calls - firewall.command: Add the removed FirewallError handling to the action (a17ce50) - firewall.command: Do not use query methods for sequences and also single options - Add missing information about MAC and ipset sources to man pages and help output - firewalld.spec: Add BuildRequires for libxslt to enable rebuild of man pages - firewall[-offline]-cmd, firewallctl, firewall.command: Use sys.{stdout,stderr} - firewallctl: Fix traceback if not connected to firewalld - firewall-config: Initialize value in on_richRuleDialogElementChooser_clicked - firewall.command: Convert errors to string for Python3 - firewall.command: Get proper firewall error code from D-BusExceptions - firewall-cmd: Fixed traceback without args - Add missing service files to Makefile.am - shell-completion: Add shell completion support for --{get,set}--{description,short} - Updated RHEL-7 selinux-policy and squid conflict- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Fix regression with unavailable optional commands - All missing backend messages should be warnings - Individual calls for missing restore commands - Only one authenticate call for add and remove options and also sequences - New service RH-Satellite-6 - Fixed selinux-policy conflict version for RHEL-7- Fixed selinux-policy conflict version for Fedora 24- New firewalld release 0.4.3.1 - firewall.command: Fix python3 DBusException message not interable error - src/Makefile.am: Fix path in firewall-[offline-]cmd_test.sh while installing - firewallctl: Do not trace back on list command without further arguments - firewallctl (man1): x X6L@ !${!! -6669: Adjust line_copy buffer to prevent overflow- redo tarball *AGAIN*, we really need to do EA-6572- EA-6569: fix `-ea_php NN` handling to set package name - EA-6542: Ignore commented out MIME Types - EA-6543: ignore .htaccess 'mime type packages' that does not contain '-php'- EA-6333: Support MultiPHP System's non ea- SCL PHPs- EA-5741: Improve php-cli handling of paths.conf- EA-5212: Update license and copyright information- EA-5110: Add /usr/local/bin/php targets to php-cli Change /usr/bin/php targets to php-cgi- EA-5120: Revert php-cli wrapper back to php-cli until EA-5106 is complete- EA-4905: Update EA4 php-cli wrapper to use php-cgi as a temporary fix for EA-4337- EA-4383: Update Release value to OBS-proof versioning- Supports new MultiPHP php.conf location- Cleaned up some minor issues with lsphp - Cleaned up test code compile issues- Add in lsphp support patch created by cloudlinux- Minor but needed change in AddType search.- Look for AddType instead of AddHandler- Add copy to /usr/local/bin/php- RPM Createdhou-2 17791222361.0.0-12.20.1.cpanel1.0.0-12.20.1.cpanellsphplsphp/usr/bin//usr/local/bin/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectionobs://private/EA4-production/CentOS_8/c9b15e4ead711ae0a31a8a0a935ea3d9-php-clicpioxz2x86_64-redhat-linux-gnuPerl script text executableUfIzKC\utf-8176333a5a1e0510f07875adef73a029c86fd4cd14d663625921d021271f42511?P؉j @o#x~|P2;2B2B+ΧMTjc*uRL%ECXsXu(*CvR7W!u);It,*k_+"+O(2c{Q{%_"s:L>Y3 8^vj @o#x~|I9`Dڶtp0yl#yuݪK5%s#7K˭ᡖm3f !Gܬ~UPY X |r\.BکqEu4 Ia<g6pHwOmy^dTPeG*|5'CF,so kcST!@JdGĆf^\FlwH]Lxnk{ 5 M[h6 z M(&Tnu# \:c;;\ҵpM~]:`d:mJ}(N?@?&s d+=4C2LeH9ʠZ--P lX924f0abd10512a00ba5f9ba4c212afca7a546e3262c794674cba833f2d5f76713af97c2c06d8ba14bd562c872d1432590b311fb6cj{x#j{xw windex.cpython-36.pycww windex.cpython-36.opt-1.pycZ6 index.3.gziniK9index-all.html 2gKindexindeterminate-circle-line.svgindeterminate-circle-fill.svgindent-increase.svgindent-decrease.svgincrease-decrease-line.svgincrease-decrease-fill.svg nincludexpath.cruc eincludekeyword.c9vincludegetattribute.csincludeconvert.ciaincludeaddkeyword.cin/includeaddattribute.c2#35%*)*9u'[18)89includeinbox-unarchive-line.svginbox-unarchive-fill.svginbox-line.svginbox-fill.svginbox-archive-line.svginbox-archive-fill.svgx`X:L>(29$(9992)- Fix CVE-2017-15088 (Buffer overflow in get_matching_data())- Drop dependency on python2-pyrad (dead upstream, broken with new python)- Actually bump kdbversion like I was supposed to- New upstream prerelease (1.16-beta1)- Add German translation- New upstream release - krb5-1.15.2 - Adjust patches as appropriate- Save other programs from worrying about CVE-2017-11462 - Resolves: #1488873 - Resolves: #1488874- Add hostname-based ccselect module - Resolves: #1463665- Backport upstream certauth EKU fixes- Backport certauth eku security fix- Backport kdc policy plugin, but this time with dependencies- Backport kdcpolicy interface* Mon Aug 07 2017 Robbie Harwood - 1.15.1-21 - Display an error message if ocsp pkinit is requested- Disable dns_canonicalize_hostname. This may break some setups.- Re-enable test suite on ppc64le (no other changes)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Fix CVE-2017-11368 (remote triggerable assertion failure)- Explicitly require python2 packages- Add support to query the SSF of a context - Pick up rename of perl dependency- Fix leaks in gss_inquire_cred_by_oid()- Fix arch name (ppc64le, not ppc64el) - Related-to: #1464381- Skip test suite on ppc64el - Related-to: #1464381- Include more test suite changes from upstream - Resolves: #1464381- Fix custom build with -DDEBUG- Use standard trigger logic for krb5 snippet- Add kprop service env config file- Update backports of certauth and corresponding test- Include fixes for previous commit - Resolves: #1433083- Automatically add includedir where not present - Try removing sleep statement to see if it is still needed - Resolves: #1433083- Fix use of enterprise principals with forwarding- Backport certauth plugin and related pkinit changes- Remove duplication between subpackages - Resolves: #1250228- New upstream release - 1.15.1- Patch build by disabling failing test; will fix properly soon- Hammer refresh around transient rawhide issue- Backport fix for GSSAPI fallback realm- Move krb5-kdb-version provides from -libs to -devel- Add free hook to KDB; increments KDB version - Add KDB version flag- New upstream release- New upstream release- Ensure we can build with the new CFLAGS - Remove the git versioning in patches- New upstream release - Update selinux with RHEL hygene - Resolves: #1314096- rebuild with OpenSSL 1.1.0, added backported upstream patch- Properly close krad sockets - Resolves: #1380836- Fix backward check in kprop.service- Switch to using autosetup macro. - Patches come from git, so it is easiest to just make a git repo- Backport getrandom() support - Remove patch numbering- New upstream release - Update names and numbers to match external git- Add krb5_db_register_keytab - Resolves: #1376812- Use responder for non-preauth AS requests - Resolves: #1370622- Guess Samba client mutual flag using ap_option - Resolves: #1370980- Fix KDC return code and set prompt types for OTP client preauth - Resolves: #1370072- Turn OFD locks back on with glibc workaround - Resolves: #1274922- Fix use of KKDCPP with SNI - Resolves: #1365027- Make krb5-devel depend on libkadm5 - Resolves: #1364487- Up-port a bunch of stuff from the el-7.3 cycle - Resolves: #1255450, #1314989- New upstream version 1.14.3- Fix CVE-2016-3120 - Resolves: #1361051- Fix incorrect recv() size calculation in libkrad- Separate out the kadm5 libs- Fix setting of AS key in OTP preauth failure- Use the correct patches this time. - Resolves: #1321135- Add send/receive sendto_kdc hooks and corresponding tests - Resolves: #1321135- Fix CVE-2016-3119 (NULL deref in LDAP module)- Backport OID mech fix - Resolves: #1317609- New rawhide, new upstream version - Drop CVE patches - Rename fix_interposer.patch to acquire_cred_interposer.patch - Update acquire_cred_interposer.patch to apply to new source- Fix log file permissions patch with our selinux - Resolves: #1309421- Backport my interposer fixes from upstream - Supersedes krb5-mechglue_inqurexXLHj 9$#999>Nalin Dahyabhai - 1.8-5Nalin Dahyabhai - 1.8-4Nalin Dahyabhai - 1.8-3Nalin Dahyabhai - 1.8-2Nalin Dahyabhai - 1.8-1Nalin Dahyabhai - 1.7.1-6Nalin Dahyabhai - 1.7.1-5Nalin Dahyabhai - 1.7.1-4Nalin Dahyabhai - 1.7.1-3Nalin Dahyabhai - 1.7.1-2Nalin Dahyabhai - 1.7.1-1Nalin Dahyabhai - 1.7-23Nalin Dahyabhai - 1.7-22Nalin Dahyabhai - 1.7-21Nalin Dahyabhai - 1.7-20Nalin Dahyabhai - 1.7-19Nalin Dahyabhai - 1.7-18Nalin Dahyabhai - 1.7-17Nalin Dahyabhai - 1.7-16Dennis Gregorovic Nalin Dahyabhai - 1.7-15Nalin Dahyabhai - 1.7-14Nalin Dahyabhai Nalin Dahyabhai - 1.7-13Nalin Dahyabhai Nalin Dahyabhai - 1.7-12Nalin Dahyabhai Nalin Dahyabhai - 1.7-11Nalin Dahyabhai - 1.7-10Nalin Dahyabhai - 1.7-9Nalin Dahyabhai Nalin Dahyabhai - 1.7-8Nalin Dahyabhai Nalin Dahyabhai - 1.7-7Tomas Mraz - 1.7-6Fedora Release Engineering - 1.7-5Nalin Dahyabhai 1.7-5Nalin Dahyabhai Nalin Dahyabhai 1.7-4Nalin Dahyabhai Nalin Dahyabhai 1.7-3Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai 1.7-2Nalin Dahyabhai 1.7-1Nalin Dahyabhai 1.6.3-106Nalin Dahyabhai 1.6.3-105Nalin Dahyabhai 1.6.3-104Nalin Dahyabhai 1.6.3-103Nalin Dahyabhai 1.6.3-102Nalin Dahyabhai Nalin Dahyabhai 1.6.3-101Nalin Dahyabhai 1.6.3-100Nalin Dahyabhai 1.6.3-19Fedora Release Engineering - 1.6.3-18Nalin Dahyabhai 1.6.3-17Nalin Dahyabhai Tom "spot" Callaway 1.6.3-16Nalin Dahyabhai Nalin Dahyabhai 1.6.3-15Tom "spot" Callaway 1.6.3-14Nalin Dahyabhai 1.6.3-13Nalin Dahyabhai 1.6.3-12Nalin Dahyabhai 1.6.3-11Nalin Dahyabhai 1.6.3-10Nalin Dahyabhai 1.6.3-9Nalin Dahyabhai 1.6.3-8Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai 1.6.3-7Nalin Dahyabhai 1.6.3-6Nalin Dahyabhai 1.6.3-5Nalin Dahyabhai 1.6.3-4Nalin Dahyabhai 1.6.3-3Nalin Dahyabhai 1.6.3-2Nalin Dahyabhai 1.6.3-1Nalin Dahyabhai 1.6.2-10Nalin Dahyabhai Nalin Dahyabhai 1.6.2-9Nalin Dahyabhai 1.6.2-8Nalin Dahyabhai 1.6.2-7Nalin Dahyabhai 1.6.2-6Nalin Dahyabhai 1.6.2-5Nalin Dahyabhai 1.6.2-4Nalin Dahyabhai 1.6.2-3Nalin Dahyabhai 1.6.2-2Nalin Dahyabhai 1.6.2-1Nalin Dahyabhai 1.6.1-8Nalin Dahyabhai 1.6.1-7Nalin Dahyabhai 1.6.1-6Nalin Dahyabhai 1.6.1-5.1Nalin Dahyabhai 1.6.1-5Nalin Dahyabhai 1.6.1-4Nalin Dahyabhai <x>X^L n$~noP(?#Xd   - )X^e @ @ @  @  @ L@ @@@8@88X [(h8p9:7> ?@G$@H$@I$@XY8\h@]h@^q>bPdeflt@u @v!"""## ##T#h#l6% %6 '((T(X@(g(h(Cdnf4.7.021.el8_10.alma.1Package managerUtility that allows users to manage packages on their systems. It supports RPMs, modules and comps groups & environments.gs390x-builder01.almalinux.org7AlmaLinuxAlmaLinuxGPLv2+AlmaLinux Packaging Team Unspecifiedhttps://github.com/rpm-software-management/dnflinuxnoarch if [ $1 -eq 1 ] ; then # Initial installation systemctl --no-reload preset dnf-makecache.timer &>/dev/null || : fi if [ $1 -eq 0 ] ; then # Package removal, not upgrade systemctl --no-reload disable --now dnf-makecache.timer &>/dev/null || : fi if [ $1 -ge 1 ] ; then # Package upgrade, not uninstall systemctl try-restart dnf-makecache.timer &>/dev/null || : fi@' CdB];X0s(tq E<$ %hzjGUY]q$P|EK2C!X"VAA큤Ag`tf`tfgg`tfgggggggggggggggggggggggggggggggggggggggggggggggggggggggggg64fd20c5163f9a310c2e0211e53d4f731285535a4798c6c074f16c1e6680304d134614a40987a0b815f14aa40c83fba85d6b8f3f38242b6a91bfc133229afc0bc2c1d7a637fb3e83e3b6b838e5859a8903eef843b806cd4670cfaf118717bbd339bd545cd56507939645004bd909cd73947169c33db6b0741579eea827421f43030b304cb6554d2ed7ca2201e53eb445fb98987978bd3a19126d1e45a0ac11290e65efd2004718ea4702bf06921dc1da35b6fac4a5ccf0634348bd5ccba8c716534ae757f7f30ab75ea441c1ca752e879d02d1f052dfff97087c7bca2a174f2caac920e827b6b12943beee47d6f8489e4b0cf229328cf7fb7f646b91b33e19b0cf313898a9ac12855ea3bac0d376a7de7374ef2bd87b3f87e8efea84a4dac5e4aa29b9d87a5bb417b4917cda7b8cd993b12af3c1e1703708f1738c21de0764b029d544de71e26580fafc1ac22330aa6c21dc1b63ab94f008055e9264b6319bb85143c469ba90a72e1f576d4799488dd30b025afb878a6519672a75eedbdfdd675bf3dea55a06ee806e044c5c4953f551093865c89fc3b64ccd5f0df191f13f69057b73b8e08e39e1c6d3c3028c931065a11c93c820a03848bab6ccddf14ed72244d97cdcde0767cf343f8683a59196d45a8fb7a982be7268f8bd4a49b0aa2543f8b13be9013154571a3c308810d479745a2a41d2c45699e553c91f8fe1ec78d174b5e1d6f37f0b7180dd8bce9cc9a879fc075f767927a376836744a5a97501ab8a4a58fa5d9ce697c77f7b83fec5248031635d02288c387a5f8ece02d1393c2d81034abf3c8d968571053a8706035492038430c805dd97edeb6dfb4ba74efxj8XL' N$ NO Nom> - 1.4.18-3Paul Wouters - 1.4.18-2Paul Wouters - 1.4.18-1Paul Wouters - 1.4.17-5Fedora Release Engineering - 1.4.17-4Paul Wouters - 1.4.17-3Adam Tkac - 1.4.17-2Paul Wouters - 1.4.17-1Paul Wouters - 1.4.16-3 Paul Wouters - 1.4.16-2Paul Wouters - 1.4.16-1Paul Wouters - 1.4.15-2Paul Wouters - 1.4.15-1Fedora Release Engineering - 1.4.14-2Paul Wouters - 1.4.14-1Paul Wouters - 1.4.13-1Tom Callaway - 1.4.12-4Paul Wouters - 1.4.12-3Paul Wouters - 1.4.12-2Paul Wouters - 1.4.12-1Paul Wouters - 1.4.11-1Paul Wouters - 1.4.10-1Paul Wouters - 1.4.9-3Paul Wouters - 1.4.9-2Paul Wouters - 1.4.9-1Paul Wouters - 1.4.8-2Paul Wouters - 1.4.8-1Paul Wouters - 1.4.5-4Paul Wouters - 1.4.5-3Paul Wouters - 1.4.5-2Paul Wouters - 1.4.5-1Paul Wouters - 1.4.4-2Paul Wouters - 1.4.4-1Paul Wouters - 1.4.3-1Paul Wouters - 1.4.2-1Paul Wouters - 1.4.1-5Paul Wouters - 1.4.1-3Paul Wouters - 1.4.1-2Paul Wouters - 1.4.1-1Paul Wouters - 1.3.4-2Paul Wouters - 1.3.4-1Tomas Mraz - 1.3.3-2Paul Wouters - 1.3.3-1Fedora Release Engineering - 1.3.0-3Paul Wouters - 1.3.0-2Paul Wouters - 1.3.0-1Paul Wouters - 1.2.1-7Paul Wouters - 1.2.1-6Paul Wouters - 1.2.1-5Adam Tkac - 1.2.1-4Adam Tkac - 1.2.1-3Fedora Release Engineering - 1.2.1-2Paul Wouters - 1.2.0-2Paul Wouters - 1.1.1-7Paul Wouters - 1.1.1-6Paul Wouters - 1.1.1-4Paul Wouters - 1.1.1-3Adam Tkac - 1.1.1-2Paul Wouters - 1.1.1-1Paul Wouters - 1.1.0-3Adam Tkac - 1.1.0-2Paul Wouters - 1.1.0-1Paul Wouters - 1.0.2-5Paul Wouters - 1.0.2-4Paul Wouters - 1.0.2-3Paul Wouters - 1.0.2-2Paul Wouters - 1.0.2-1Paul Wouters - 1.0.1-1Paul Wouters - 1.0.0-2Paul Wouters - 1.0.0-1Wouter Wijngaards - 0.12Wouter Wijngaards - 0.11- Add unit test for CVE-2026-44690 from upstream.- Fix CVE-2026-44690 (RHEL-212801)- Fix CVE-2026-40622 (RHEL-184832) - Fix CVE-2026-44390 (RHEL-186680) - Fix CVE-2026-41292 (RHEL-187346) - Fix CVE-2026-42534 (RHEL-187081)- Fix CVE-2026-42944 (RHEL‑177909) - Fix CVE-2026-42959 (RHEL-177809)- Add new root key 38696 (RHEL-131172) - Update unbound-anchor built-in dnssec key- Fix RebirthDay Attack (CVE-2025-5994) - Resolves: RHEL-104123- Prevent unbounded name compression (CVE-2024-8508)- Rebuild to propagate to CentOS Stream (RHEL-25500)- Ensure group access correction reaches also updated configs (CVE-2024-1488)- Ensure only unbound group can change configuration (CVE-2024-1488)- Fix KeyTrap - Extreme CPU consumption xX?L0P' $ .net> - 7.4.26-1Dan Muey - 7.4.25-2Cory McIntire - 7.4.25-1Julian Brown - 7.4.24-23Cory McIntire - 7.4.24-2Cory McIntire - 7.4.24-1Travis Holloway - 7.4.23-1Cory McIntire - 7.4.22-1Cory McIntire - 7.4.21-1Travis Holloway - 7.4.20-2Cory McIntire - 7.4.20-1Cory McIntire - 7.4.19-1Cory McIntire - 7.4.18-1Cory McIntire - 7.4.16-2Cory McIntire - 7.4.16-1Cory McIntire - 7.4.15-1Cory McIntire - 7.4.14-1Julian Brown - 7.4.13-2Cory McIntire - 7.4.13-1Tim Mullin - 7.4.12-2Cory McIntire - 7.4.12-1Daniel Muey - 7.4.11-4Tim Mullin - 7.4.11-3Daniel Muey - 7.4.11-2Cory McIntire - 7.4.11-1Tim Mullin - 7.4.10-2Cory McIntire - 7.4.10-1Cory McIntire - 7.4.9-1Tim Mullin - 7.4.8-2Cory McIntire - 7.4.8-1Julian Brown - 7.4.7-2Cory McIntire - 7.4.7-1Tim Mullin - 7.4.6-3Tim Mullin - 7.4.6-2Cory McIntire - 7.4.6-1Daniel Muey - 7.4.5-3Tim Mullin - 7.4.5-2Cory McIntire - 7.4.5-1Julian Brown - 7.4.2-3Daniel Muey - 7.4.2-2Daniel Muey - 7.4.2-1Dan Muey - 7.4.1-1- EA4-173: Mark ea-php74 as EOL- EA4-230: Use system libxml2 in PHP 7.4- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12614: Rolling “ea-php74” back to “2ae8a0c01d69dbc710734ff516c17a19a479fa13”: was not meant to be merged- ZC-12614: Build on Alma 9- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- ZC-12246: Correct conffiles for Ubuntu- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: work around `%doc` and `PHP` behavior changes from C7 to c9- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link with libc-client statically- ZC-10873: Do not build on Ubuntu 22- EA-11075: Correct default value description for log_errors in php.ini- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11038: Update ea-php74 from v7.4.32 to v7.4.33- EA-10957: Update ea-php74 from v7.4.30 to v7.4.32- EA-10757: Update ea-php74 from v7.4.29 to v7.4.30- EA-10632: Update ea-php74 from v7.4.28 to v7.4.29- EA-10532: Update litespeed to 8.0.1- EA-10504: Update ea-php74 from v7.4.27 to v7.4.28- EA-10461: Patch PHP-FPM/OpCache for kill_all_lockers bug (74709)- ZC-9611: Dependency issue with php-enchant.- ZC-9598: Fix Ubuntu 21 global regs problem- ZC-7454: Add php-sodium- EA-10364: Update ea-php74 from v7.4.26 to v7.4.27- EA-10279: Update ea-php74 from v7.4.25 to v7.4.26- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10228: Update ea-php74 from v7.4.24 to v7.4.25- ZC-9368: Correct build issues from changes to ea-tools- EA-10137: disable upstream regression tests in favor of our own- EA-10136: Update ea-php74 from v7.4.23 to v7.4.24- EA-10081: Update ea-php74 from v7.4.22 to v7.4.23- EA-10009: Update ea-php74 from v7.4.21 to v7.4.22- EA-9925: Update ea-php74 from v7.4.20 to v7.4.21- EA-9013: Optimize %check section- EA-9831: Update ea-php74 from v7.4.19 to v7.4.20- EA-9752: Update ea-php74 from v7.4.18 to v7.4.19- EA-9737: Update ea-php74 from v7.4.16 to v7.4.18- EA-9625: Update litespeed to 7.9- EA-9622: Update ea-php74 from v7.4.15 to v7.4.16- EA-9565: Update eax(XLPa$)s page- Add glade file- Fix Module handling in system-config-selinux- Update to upstream * Merged newrole patch set from Michael Thompson. - Add policycoreutils-gui- No longer requires rhpl- Fix genhomedircon man page- Add newrole audit patch from sgrubb - Update to upstream * Merged audit2allow -l fix from Yuichi Nakamura. * Merged restorecon -i and -o - support from Karl MacMillan. * Merged semanage/seobject fix from Dan Walsh. * Merged fixfiles -R and verify changes from Dan Walsh.- Separate out newrole into its own package- Update to upstream * Merged newrole auditing of failures due to user actions from Michael Thompson.- Pass -i qualifier to restorecon for fixfiles -R - Update translations- Remove recursion from fixfiles -R calls - Fix semanage to verify prefix- More translations - Compile with -pie- Add translations - Fix audit2allow -l- Rebuild- Update to upstream - Change -o to take "-" for stdout- Add -h support for genhomedircon- Fix fixfiles handling of -o- Make restorecon return the number of changes files if you use the -n flag- Change setfiles and restorecon to use stderr except for -o flag - Also -o flag will now output files- Put back Erich's change- Remove recursive switch when using rpm- Fix fixfiles to handle multiple rpm and make -o work- Apply patch- Security fixes to run python in a more locked down manner - More Translations - Update to upstream * Merged fix for restorecon // handling from Erich Schubert. * Merged translations update and fixfiles fix from Dan Walsh.- Change scripts to use /usr/sbin/python- Add -i qualified to restorecon to tell it to ignore files that do not exist - Fixfiles also modified for this change- Ignore sigpipe- Fix init script and add translations- Update to upstream * Merged fix for restorecon symlink handling from Erich Schubert.- Update to upstream * Merged semanage local file contexts patch from Chris PeBenito. - Fix fixfiles log creation - More translations- Update to upstream * Merged patch from Dan Walsh with: * audit2allow: process MAC_POLICY_LOAD events * newrole: run shell with - prefix to start a login shell * po: po file updates * restorecond: bail if SELinux not enabled * fixfiles: omit -q * genhomedircon: fix exit code if non-root * semodule_deps: install man page * Merged secon Makefile fix from Joshua Brindle. * Merged netfilter contexts support patch from Chris PeBenito.- Fix audit2allow to handle reload of policy- Stop restorecond init script when selinux is not enabled- Update to upstream * Merged restorecond size_t fix from Joshua Brindle. * Merged secon keycreate patch from Michael LeMay. * Merged restorecond fixes from Dan Walsh. Merged updated po files from Dan Walsh. * Merged python gettext patch from Stephen Bennett. * Merged semodule_deps from Karl MacMillan.- Change newrole to exec a login shell to prevent suspend.- Report error when selinux not enabled in restorecond- Fix handling of restorecond- Fix creation of restorecond pidfile- Update translations - Update to new GCC- Add verbose flag to restorecond and update translations- Update to upstream * Lindent. * Merged patch from Dan Walsh with: * -p option (progress) for setfiles and restorecon. * disable context translation for setfiles and restorecon. * on/off values for setsebool. * Merged setfiles and semodule_link fixes from Joshua Brindle.- Add progress indicator on fixfiles/setfiles/restorecon- Don't use translations with matchpathcon- Prompt for selinux-policy-devel package in audit2allow- Allow setsebool to use on/off - Update translations- Update to upstream * Merged fix for setsebool error path from Serge Hallyn. * Merged patch from Dan Walsh with: * Updated poxXL$=ommand. From mgrepl.- Fix sepolgen handling of unit files.- Require selinux-policy-doc- Fix unit file handling in sepolgen- Add bash_command completion for setsebool/getsebool- Disable restorecond on desktop by default - Change seunshare to not modify the bounding set- Stop using sandbox init in post install since it no longer exists.- Change to use new selinux_current_policy_path()- Change to use new selinux_binary_policy_path() - Add systemd_passwd_agent_exec($1), and systemd_read_fifo_file_passwd_run($1) to templates for _admin interface- On full relabels we will now show a estimated percent complete rather then just *s.- Add unit_file.py for sepolgen- Change sepolgen to use sha256 instead of md5- Stop syslogging on full restore - Stop syslogging when restorecon is not changing values- Change semanage to produce proper audit records for Common Criteria - Cleanup packaging for usrmove- fixed load_policy location- fixed load_policy location- fixed load_policy location- add filesystem guard- install everything in /usr https://fedoraproject.org/wiki/Features/UsrMove- restorecond fixes: Stop using depracated g_io interfaces Exit with non zero exit code if wrong options given Add -h option- Eliminate not needed Requires- fix sepolgen to not crash on echo "" | audit2allow- Remove sandbox init script, should no longer be necessary- Add unit file support to sepolgen, and cleanup some of the output.- Fix English in templates for sepolgen- Fix the handling of namespaces in seunshare/sandbox. - Currently mounting of directories within sandbox is propogating to the - parent namesspace.- Add umount code to seunshare to cleanup left over mounts of /var/tmp- Remove open_init_pty-Update to upstream - sepolgen * better analysis of why things broke - policycoreutils * Remove excess whitespace * sandbox: Add back in . functions to sandbox.init script * Fix Makefile to match other policycoreutils Makefiles * semanage: drop unused translation getopt- Bump libsepol version requires rebuild- Add back accidently dropped patches for semanage- Upgrade to upstream * sandbox: move sandbox.conf.5 to just sandbox.5 * po: Makefile use -p to preserve times to allow multilib simultatious installs * of po files * sandbox: Allow user to specify the DPI value for X in a sandbox * sandbox: make sure the domain launching sandbox has at least 100 categories * sandbox: do not try forever to find available category set * sandbox: only complain if sandbox unable to launch * sandbox: init script run twice is still successful * semanage: print local and dristo equiv rules * semanage: check file equivalence rules for conflict * semanage: Make sure semanage fcontext -l -C prints even if local keys * are not defined * semanage: change src,dst to target,substitute for equivalency * sestatus: Updated sestatus and man pages. * Added SELinux config file man page. * add clean target to man Makefile- Fix semange fcontext -a to check for more conflicts on equivalency- Fix dpi handling in sandbox - Make sure semanage fcontext -l -C prints if only local equiv have changed- Add listing of distribution equivalence class from semanage fcontext -l - Add checking to semanage fcontext -a to guarantee a file specification will not be masked by an equivalence- Allow ~ as a valid part of a filename in sepolgen- sandbox init script should always return 0 - sandbox command needs to check range of categories and report error if not big enough- Allow user to specify DPI when running sandbox- Add Miroslav patch to return all attributes- Upgrade to policycoreutils upstream * sandbox: Maintain the LANG environment into the sandbox * audit2allow: use audit2why internally * fixfiles: label /root but not /var/lib/BackupPC * semanage: update local boolean settings is dealing with localstore * semanage: missing modifxhXLi-$yi-h-j-../usr/bin/filan../../../../usr/bin/procan../../../../usr/bin/socatrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsocat-1.7.4.1-2.el8_10.src.rpmsocatsocat(x86-64)@@@@@@@@@@@@@@@@    @libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libreadline.so.7()(64bit)librt.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libutil.so.1()(64bit)libutil.so.1(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3h>`c]@]µZ}@ZN@Y@YyXO@XX@XwoWX@VU@TÉ@SSP@SB@R@QB@QJQJQ#@P O@O3NyMRLrbKd@J@JJ@JlE@J@I2IuIsHHGGVGVEّ@Eّ@EODND6D`@CعCعStepan Broz - 1.7.4.1-2Paul Wouters - 1.7.4.1-1Paul Wouters - 1.7.3.3-2Paul Wouters - 1.7.3.3-1Fedora Release Engineering - 1.7.3.2-6Paul Wouters - 1.7.3.2-5Fedora Release Engineering - 1.7.3.2-4Fedora Release Engineering - 1.7.3.2-3Paul Wouters - 1.7.3.2-3Fedora Release Engineering - 1.7.3.2-2Paul Wouters - 1.7.3.2-1Igor Gnatenko - 1.7.3.1-2Paul wouters - 1.7.3.1-1Fedora Release Engineering - 1.7.2.4-6Fedora Release Engineering - 1.7.2.4-5Paul Wouters - 1.7.2.4-4Fedora Release Engineering - 1.7.2.4-3Fedora Release Engineering - 1.7.2.4-2Paul Wouters - 1.7.2.4-1Paul Wouters - 1.7.2.3-1Fedora Release Engineering - 1.7.2.2-3Paul Wouters - 1.7.2.2-2Paul Wouters - 1.7.2.2-1Fedora Release Engineering - 1.7.2.1-3Fedora Release Engineering - 1.7.2.1-2Paul Wouters - 1.7.2.1-1Paul Wouters - 1.7.2.0-1Paul Wouters - 1.7.1.3-3Fedora Release Engineering - 1.7.1.3-2Paul Wouters - 1.7.1.3-1Paul Wouters - 1.7.1.2-1Caolán McNamara - 1.7.1.1-5Paul Wouters - 1.7.1.1-4Tomas Mraz - 1.7.1.1-3Fedora Release Engineering - 1.7.1.1-2Paul Wouters - 1.7.1.1-1Fedora Release Engineering - 1.7.0.0-2Paul Wouters 1.6.0.1-3Tom "spot" Callaway 1.6.0.1-2Tom "spot" Callaway 1.6.0.1-1Fedora Release Engineering - 1.5.0.0-8Release Engineering -xvXLmB$RBCApanel.net> - 8.0.27-1Cory McIntire - 8.0.26-1Travis Holloway - 8.0.25-2Cory McIntire - 8.0.25-1Cory McIntire - 8.0.24-1Julian Brown - 8.0.23-3Dan Muey - 8.0.23-2Cory McIntire - 8.0.23-1Cory McIntire - 8.0.22-1Cory McIntire - 8.0.21-1Cory McIntire - 8.0.20-1Cory McIntire - 8.0.19-1Cory McIntire - 8.0.18-1Cory McIntire - 8.0.17-1Travis Holloway - 8.0.16-2Cory McIntire - 8.0.16-1Cory McIntire - 8.0.15-1Julian Brown - 8.0.14-5Dan Muey - 8.0.14-4Julian Brown - 8.0.14-3Julian Brown - 8.0.14-2Cory McIntire - 8.0.14-1Cory McIntire - 8.0.13-1Dan Muey - 8.0.12-2Cory McIntire - 8.0.12-1Tim Mullin - 8.0.11-4Julian Brown - 8.0.11-3Cory McIntire - 8.0.11-2Cory McIntire - 8.0.11-1Travis Holloway - 8.0.10-1Cory McIntire - 8.0.9-1Julian Brown - 8.0.8-2Travis Holloway - 8.0.8-1Travis Holloway - 8.0.7-2Cory McIntire - 8.0.7-1Cory McIntire - 8.0.6-1Cory McIntire - 8.0.5-1Cory McIntire - 8.0.3-2Cory McIntire - 8.0.3-1Cory McIntire - 8.0.2-1Tim Mullin - 8.0.1-1Daniel Muey - 8.0.0-2Daniel Muey - 8.0.0-1Julian Brown - 8.0.0rc4-5Daniel Muey - 8.0.0rc4-4Daniel Muey - 8.0.0rc4-3Daniel Muey - 8.0.0rc4-2Daniel Muey - 8.0.0rc4-1Daniel Muey - 8.0.0rc3-5Tim Mullin - 8.0.0rc3-3Daniel Muey - 8.0.0rc3-2Daniel Muey - 8.0.0rc3-1Daniel Muey - 8.0.0beta4-2Daniel Muey - 8.0.0beta4-1Julian Brown - 8.0.0alpha3-2Julian Brown - 8.0.0alpha3-1- EA4-173: Mark ea-php80 as EOL- EA4-230: Use system libxml2 in PHP 8.0- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- ZC-12246: Correct conffiles for Ubuntu- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: Correct Ubuntu Build issues- EA-11590: Update ea-php80 from v8.0.29 to v8.0.30 - Libxml: Fixed bug GHSA-3qrf-m4j2-pcrr (Security issue with external entity loading in XML without enabling it). (CVE-2023-3823) - Phar: Fixed bug GHSA-jqcx-ccgc-xwhv (Buffer mismanagement in phar_dir_read()). (CVE-2023-3824)- EA-11475: Update ea-php80 from v8.0.28 to v8.0.29 - Fixed bug GHSA-76gg-c692-v2mw (Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP).- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link statically with libc-client- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- ZC-10873: Simplify the libidn deps, for building on Ubunut 20 and 22- EA-11227: Update ea-php80 from v8.0.27 to v8.0.28 - Fixed bug #81744 (Password_verify() always return true with some hash). (CVE-2023-0567) - Fixed bug #81746 (1-byte array overrun in common path resolve code). (CVE-2023-0568) - Fixed bug GHSA-54hq-v5wp-fqgv (DOS vulnerability when parsing multipart request body). (CVE-2023-0662)- EA-11075: Correct default value dxfXXL`*$q**K?d   ,`d|  jAA jA A A 1A AAA4A8g(89|:?>o~?oGoAHpAIqAXr0YrL\rpA]stA^u8b|?d}e}f}l}t}Au~AvwLAxPAyT   6_AghCgrep3.16.el8Pattern matching utilitiesThe GNU versions of commonly used grep utilities. Grep searches through textual input for lines which contain a match to a specified pattern and then prints the matching lines. GNU's grep utilities include grep, egrep and fgrep. GNU grep is needed by many scripts, so it shall be installed on every system.]build.cloudlinux.com CloudLinuxCloudLinuxGPLv3+CloudLinux Packaging Team Applications/Texthttp://www.gnu.org/software/grep/linuxx86_64/sbin/install-info --quiet --info-dir=/usr/share/info /usr/share/info/grep.info.gz || :if [ $1 = 0 ]; then /sbin/install-info --quiet --info-dir=/usr/share/info --delete /usr/share/info/grep.info.gz || : fi^ % dx,(tL Xh11.S2'//>y;11CZ".1oDE.A0I q /DCbD0V+W051>1>1>@>@>>>k@>k@>@>@>@>@>@>@>Ԥ>.='=@=9P=@< - 3.1-6Fedora Release Engineering - 3.1-5Jaroslav Škarvada - 3.1-4Fedora Release Engineering - 3.1-3Fedora Release Engineering - 3.1-2Jaroslav Škarvada - 3.1-1Jaroslav Škarvada - 3.0-1Jaroslav Škarvada - 2.28-1Jaroslav Škarvada - 2.27-1Jaroslav Škarvada - 2.26-2Jaroslav Škarvada - 2.26-1Jaroslav Škarvada - 2.25-1Jaroslav Škarvada - 2.24-1Jaroslav Škarvada - 2.23-1Fedora Release Engineering - 2.22-7Jaroslav Škarvada - 2.22-6Jaroslav Škarvada - 2.22-5Jaroslav Škarvada - 2.22-4Jaroslav Škarvada - 2.22-3Jaroslav Škarvada - 2.22-2Jaroslav Škarvada - 2.22-1Peter Robinson 2.21-7Fedora Release Engineering - 2.21-6Jaroslav Škarvada - 2.21-5Till Maas - 2.21-4Jaroslav Škarvada - 2.21-3Jaroslav Škarvada - 2.21-2Jaroslav Škarvada - 2.21-1Jaroslav Škarvada - 2.20-7Jaroslav Škarvada - 2.20-6Jaroslav Škarvada - 2.20-5Fedora Release Engineering - 2.20-4Tom Callaway - 2.20-3Fedora Release Engineering - 2.20-2Jaroslav Škarvada - 2.20-1Jaroslav Škarvada - 2.19-1Jaroslav Škarvada - 2.18-1Jaroslav Škarvada - 2.17-1Jaroslav Škarvada - 2.16-1Jaroslav Škarvada - 2.15-2Jaroslav Škarvada - 2.15-1Fedora Release Engineering - 2.14-5Jaroslav Škarvada - 2.14-4Fedora Release Engineering - 2.14-3Jaroslav Škarvada - 2.14-2Jaroslav Škarvada - 2.14-1Fedora Release Engineering - 2.13-2Jaroslav Škarvada - 2.13-1Jaroslav Škarvada - 2.12-1Jaroslav Škarvada - 2.11-1Petr Pisar - 2.10-3Fedora Release Engineering - 2.10-2Jaroslav Škarvada - 2.10-1Jaroslav Škarvada - 2.9-3Jaroslav Škarvada - 2.9-2Jaroslav Škarvada - 2.1.11-3Dan Walsh - 2.1.11-2Dan Walsh - 2.1.11-1Dan Walsh - 2.1.11-18Dan Walsh - 2.1.11-17Dan Walsh - 2.1.11-16Dan Walsh - 2.1.11-15Dan Walsh - 2.1.11-12Dan Walsh - 2.1.11-11Dan Walsh - 2.1.11-10Dan Walsh - 2.1.11-9Dan Walsh - 2.1.11-8Dan Walsh - 2.1.11-7Dan Walsh - 2.1.11-6Dan Walsh - 2.1.11-5Dan Walsh - 2.1.11-4Dan Walsh - 2.1.11-3Dan Walsh - 2.1.11-2Dan Walsh - 2.1.11-1Dan Walsh - 2.1.10-30Dan Walsh - 2.1.10-29Dan Walsh - 2.1.10-28Dan Walsh - 2.1.10-27Dan Walsh - 2.1.10-26Dan Walsh - 2.1.10-25Dan Walsh - 2.1.10-24Dan Walsh - 2.1.10-23Dan Walsh - 2.1.10-22Dan Walsh - 2.1.10-21Dan Walsh - 2.1.10-20Dan Walsh - 2.1.10-19Dan Walsh - 2.1.10-18Dan Walsh - 2.1.10-17Harald Hoyer 2.1.10-16Harald Hoyer 2.1.10-15Harald Hoyer 2.1.10-14Harald Hoyer 2.1.10-13Harald Hoyer 2.1.10-12Dan Walsh - 2.1.10-11Dan Walsh - 2.1.10-10Dan Walsh - 2.1.10-9Dan Walsh - 2.1.10-8Dan Walsh - 2.1.10-7Dan Walsh - 2.1.10-5Dan Walsh - 2.1.10-4Dan Walsh - 2.1.10-3Dan Walsh - 2.1.10-2Dan Walsh - 2.1.10-1Dan Walsh - 2.1.9-3Dan Walsh - 2.1.9-2Dan Walsh - 2.1.9-1Dan Walsh - 2.1.8-8Dan Walsh - 2.1.8-7Dan Walsh - 2.1.8-6Dan Walsh - 2.1.8-5Dan Walsh - 2.1.8-4Dan Walsh - 2.1.8-3Dan Walsh - 2.1.8-2Dan Walsh - 2.1.8-1Dan Walsh - 2.1.7-6Dan Walsh - 2.1.7-5Dan Walsh - 2.1.7-4Dan Walsh - 2.1.7-3Dan Walsh - 2.1.7-2Dan Walsh - 2.1.7-1Dan Walsh - 2.1.6-3Dan Walsh - 2.1.6-2Dan Walsh - 2.1.6-1Dan Walsh - 2.1.5-6Dan Walsh - 2.1.5-5Dan Walsh - 2.1.5-4Dan Walsh - 2.1.5-3Dan Walsh - 2.1.5-2Dan Walsh - 2.1.5-1Dan Walsh - 2.1.4-2Dan Walsh - 2.1.4-1Dan Walsh 2.0.86-20Dan Walsh 2.0.86-18Dan Walsh 2.0.86-17Dan Walsh 2.0.86-16Jóhann B. Guðmundsson - 2.0.86-15Dan Walsh 2.0.86-14Dan Walsh 2.0.86-13Dan Walsh 2.0.86-12Dan Walsh 2.0.86-11Dan Walsh 2.0.86-10Dan Walsh 2.0.86-9Dan Walsh 2.0.86-8Dan Walsh 2.0.86-7Dan Walsh 2.0.86-6Dan Walsh 2.0.86-5Dan Walsh 2.0.86-4Dan Walsh 2.0.86-2Dan Walsh 2.0.86-1Dan Walsh 2.0.85-30Dan Walsh 2.0.85-29Dan Walsh 2.0.85-28Dan Walsh 2.0.85-27Dan Walsh 2.0.85-26Dan Walsh 2.0.x0cp4Xr LXIP$@PO.972f756b6b080a39d093402580eabc6502XXdL@, PD0$`T|l`D8(0$ t ( | p ` T H 4   | h xh\D8X L 8 ,  x l \ P 4 (   x l X L XL< 0 $   x \ P 4 (   @4 3 re_comp.h records.hrebol.pyrdf.py` rdtypes rebuild.pyi rds-data rds recent-cpre.pyore.pycre.py readline.sordsosreport.shU;re6.alU:re.al&} rdma.8.gz&|rdma-system.8.gz&{rdma-statistic.8.gz&zrdma-resource.8.gz&yrdma-link.8.gz&x rdma-dev.8.gz reader4.res reader4.c reader3.res~ reader3.c} reader2.c| reader1.res{ reader1.ck record.h[D rdatatype.pyo[C rdatatype.pyc[B_ rdatatype.py[A rdataset.pyo[@ rdataset.pyc[?^ rdataset.pyrecord-mail-line.svgrecord-mail-fill.svgzsrecord-circle-line.svgyirecord-circle-fill.svgs-larecommendationson0 v rebuild.py-ge.trebuild.cpython-36.pyccal- rebuild.cpython-36.opt-1.pyc2WuKreboot.hrZ; reboot.2.gzomZ realpath.3p.gzt-hZ realpath.3.gzMM lrealmdve(Z realloc.3p.gzZy realloc.3.gzyfreal-export-setup.tctereal-export-href.t- Sgreal-export-groupgen.tctuZ p readv.3p.gz0Z:n readv.2.gzrZ-readonly.1p.gzsBereadonly-root.serviceBB readonly-root! readme.html2-Z9-readlinkat.2.gzisZ ireadlink.3p.gztZ8h readlink.2.gz2 reader.pyZreaddir_r.3.gzunz5 readdir.hZ c readdir.3p.gzZ readdir.3.gzkZ7r readdir.2.gzhZ6.readahead.2.gzrMM f readaheadZ read.3p.gzythZ5y read.2.gzZn read.1p.gzr reactjs-line.svgg reactjs-fill.svggZs re_exec.3.gzqZo re_comp.3.gz-w e re-vendor.py-w1ire-vendor.cpython-36.pyc w0dre-vendor.cpython-36.opt-1.pyccesWFrds.h!ardoc.jsniW'rdma_user_rxe.hcoW rdma_user_ioctl_cmds.hdenW^rdma_user_ioctl.hWirdma_user_cm.hdhaWxrdma_netlink.he.hW&5nrdmacMM nrdisc[>ardataclass.pyor[=rdataclass.pycM[<] r rdataclass.pyx8$X9L'($G?$d! ' Q(,DHS^o    0 P  @`  q (8)9@):)GDHdIXY\]^Dbdefltuvwxy 48  ghCperl-XML-NamespaceSupport1.124.el8A simple generic name space support classThis module offers a simple to process name-spaced XML names (unames) from within any application that may need them. It also helps maintain a prefix to name space URI map, and provides a number of basic checks.]'build.cloudlinux.comCloudLinuxCloudLinuxGPL+ or ArtisticCloudLinux Packaging Team Unspecifiedhttp://search.cpan.org/dist/XML-NamespaceSupport/linuxnoarch GwMA큤A큤A큤]'XnXn]'Xn]']'Xn393e09290b6f959f76553b122082fefc79e53912093c6df3211b7d4b0339b574cf6f498ad1b52e6efd1700d0a122e1f54e03e48978268969b6e8b9e604c61a8e3fed787f0f9e1d74024ec7ae5f0f4736c693bcf263781da2054eb4bb1337e9111b61f5d806068c99680bf7adad599237c9e83180d1a4a535bdc3c64d85bcf21262529604853467c7c581ba3ec7675daf2c0281127a899ee4d09f40c70dd0c73drootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-XML-NamespaceSupport-1.12-4.el8.src.rpmperl(XML::NamespaceSupport)perl-XML-NamespaceSupport@@@@    perl(:MODULE_COMPAT_5.26.3)perl(constant)perl(strict)perl(vars)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.2Z}@YyY3@XDXW8dV2V=@UUn@S@SQB@Q@QP;a@P H@OOMAMRM9L)@KFKK`*K@J1@JlE@I@GPG}G@E@D@CEC@C!y@Bss@AQi@=@Fedora Release Engineering - 1.12-4Fedora Release Engineering - 1.12-3Jitka Plesnikova - 1.12-2Petr Pisar - 1.12-1Fedora Release Engineering - 1.11-20Jitka Plesnikova - 1.11-19Jitka Plesnikova - 1.11-18Fedora Release Engineering - 1.11-17Fedora Release Engineering - 1.11-16Jitka Plesnikova - 1.11-15Jitka Plesnikova - 1.11-14Fedora Release Engineering - 1.11-13Fedora Release Engineering - 1.11-12Petr Pisar - 1.11-11Fedora Release Engineering - 1.11-10Jitka Plesnikova - 1.11-9Fedora Release Engineering - 1.11-8Petr Pisar - 1.11-7Fedora Release Engineering - 1.11-6Marcela Mašláňová - 1.11-5Fedora Release Engineering - 1.11-4Marcela Maslanova - 1.11-3Lubomir Rintel - 1.11-2Petr Pisar save:ahorrar (Máximo Castañeda) - cosmetic: option arg in Base.*install is replaced with strict (Jan Silhan) - group: don't fail on first non-existing group (Jan Silhan) - install: skips local pkgs of lower version when strict=0 (Related:RhBug:1227952) (Jan Silhan) - install: skip broken/conflicting packages in groups when strict=0 (Jan Silhan) - install: skip broken/conflicting packages when strict=0 (Jan Silhan) - implemented `strict` config option working in install cmd (RhBug:1197456) (Jan Silhan) - fixed 'dnf --quiet repolist' lack of output (RhBug:1236310) (Nick Coghlan) - Add support for MIPS architecture (Michal Toman) - package: respect baseurl attribute in localPkg() (RhBug:1219638) (Michal Luscon) - Download error message is not written on the same line as progress bar anymore (RhBug: 1224248) (Adam Salih) - dnf downgrade does not try to downgrade not installed packages (RhBug: 1243501) (max9631) - pkgs not installed due to rpm error are reported (RhBug:1207981) (Adam Salih) - dnf install checks availability of all given packages (RhBug:1208918) (Adam Salih) - implemented install_weak_deps config option (RhBug:1221635) (Jan Silhan) - ignore SIGPIPE (RhBug:1236306) (Michael Mraka) - always add LoggingTransactionDisplay to the list of transaction displays (RhBug:1234639) (Radek Holy) - Add missing FILES section (RhBug: 1225237) (Adam Salih) - doc: Add yum vs dnf hook information (RhBug:1244486) (Parag Nemade) - doc: clarify the expected type of the do_transactions's display parameter (Radek Holy) - apichange: add dnf.cli.demand.DemandSheet.transaction_display (Radek Holy) - apichange: add dnf.callback.TransactionProgress (Radek Holy) - move the error output from TransactionDisplay into a separate class (Radek Holy) - rename TransactionDisplay.errorlog to TransactionDisplay.error (Radek Holy) - report package verification as a regular RPM transaction event (Radek Holy) - rename TransactionDisplay.event to TransactionDisplay.progress (Radek Holy) - apichange: deprecate dnf.callback.LoggingTransactionDisplay (Radek Holy) - use both CliTransactionDisplay and demands.transaction_display (Radek Holy) - apichange: accept multiple displays in do_transaction (Radek Holy) - support multiple displays in RPMTransaction (Radek Holy)- Fix regression in group list command introduced by 02c3cc3 (Adam Salih) - AUTHORS: updated (Jan Silhan) - stop saying "experimental" (Matthew Miller)- fixed python3 syntax error from f427aa2 (Jan Silhan)- give --allowerasing hint when error occurs during resolution (RhBug:1148630) (Jan Silhan) - show --best hint with skipped packages every time (RhBug:1176351) (Jan Silhan) - notify about skipped packages when upgrade (RhBug:1210445) (Jan Silhan) - dnf-automatic: Document apply_updates=no behavior wrt keepcache (Ville Skyttä) - persistor: share functionality of JSONDB (Jan Silhan) - keepcache=0 persists packages till next successful transaction (RhBug:1220074) (Jan Silhan) - do not use releasever in cache path (related to RhBug:1173107) (Michael Mraka) - doc: add dnf list use case (Michal Luscon) - repo: allow ntlm proxy auth (RhBug:1219199) (Michal Luscon) - add a script which updates release notes (Radek Holy) - doc: reverse the order of release notes (Radek Holy) - completion_helper: fix tb if list XXX is not known arg (RhBug:1220040) (Igorx(X>Lpi $ F)H?$td , j 2? C`{    < D x  (8(F9@F:YFF 5G HH XI hX lY x\ ] ^!b!c"d#,e#1f#4l#6t#Pu#`v#pz$$$$($.$p$$& & (()4)8)<g)@h)DCea-php74-php-pspell7.4.3318.24.7.cpanelEOL A module for PHP applications for using pspell interfacesphp 7.4 has reached End of Life. The ea-php74-php-pspell package contains a dynamic shared object that will add support for using the pspell library to PHP.jhou-1cmEA4-production / CentOS_8cPanel, Inc.PHPSystem Environment/Librarieshttps://endoflife.date/phplinuxx86_645c8DAjmjjj59bf3e05bbc58064f729beeca4230ce90b7d8be1b8c3a3cbb3a07fd051407fc0acb90cb4d5cf66e4c1e78882b3031dfff73f0c1e7950c8c87208710981250ae6../../../../opt/cpanel/ea-php74/root/usr/lib64/php/modules/pspell.sorootrootrootrootrootrootrootrootea-php74-php-7.4.33-18.24.7.cpanel.src.rpmconfig(ea-php74-php-pspell)ea-php74-php-pspellea-php74-php-pspell(x86-64)@@@@@    @config(ea-php74-php-pspell)ea-php74-php-cli(x86-64)ea-php74-php-common(x86-64)libaspell.so.15()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpspell.so.15()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel7.4.33-18.24.7.cpanel3.0.4-14.6.0-14.0-15.2-14.14.3iC@id@hgv@g@g~hg@fo@f@e4@ehy@eddu@dbd,@c@cs@cc@c5bbX b\@b@b[@ada@aa{a@@a@as@a]aV@aMa'@a@`ݮ@`ٹ``@`@`B@`@`__0@_Í@_@_F@__]@_"_u_R,@_P_+_@_^^n@^@^x^2^@^1^H^|@^f/^:@^Brian Mendoza - 7.4.33-18Gary Stanley - 7.4.33-17Chris Castillo - 7.4.33-16Cory McIntire - 7.4.33-15Dan Muey - 7.4.33-14Dan Muey - 7.4.33-13Julian Brown - 7.4.33-12Dan Muey - 7.4.33-11Julian Brown - 7.4.33-10Travis Holloway - 7.4.33-9Tim Mullin - 7.4.33-8Dan Muey - 7.4.33-7Travis Holloway - 7.4.33-6Julian Brown - 7.4.33-5Julian Brown - 7.4.33-4Tim Mullin - 7.4.33-3Travis Holloway - 7.4.33-2Cory McIntire - 7.4.33-1Cory McIntire - 7.4.32-1Cory McIntire - 7.4.30-1Cory McIntire - 7.4.29-1Travis Holloway - 7.4.28-2Cory McIntire - 7.4.28-1Tim Mullin - 7.4.27-5Julian Brown - 7.4.27-4Julian Brown - 7.4.27-3Julian Brown - 7.4.27-2Cory McIntire - 7.4.27-1Cory McIntire 20- fix build failure caused by change of prototype for glibc |eventfd()| (#1147887)- fix for CVE-2014-5351 (#1145425) "krb5: current keys returned when randomizing the keys for a service principal"- fix the problem where the %license file has been a dangling symlink- kpropd hasn't bothered with -S since 1.11; stop trying to use that flag in the systemd unit file- update to 1.13 alpha1 - drop upstreamed and backported patches- pull in upstream fix for an incorrect check on the value returned by a strdup() call (#1132062)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- update to 1.12.2 - drop patch for RT#7820, fixed in 1.12.2 - drop patch for #231147, fixed as RT#3277 in 1.12.2 - drop patch for RT#7818, fixed in 1.12.2 - drop patch for RT#7836, fixed in 1.12.2 - drop patch for RT#7858, fixed in 1.12.2 - drop patch for RT#7924, fixed in 1.12.2 - drop patch for RT#7926, fixed in 1.12.2 - drop patches for CVE-2014-4341/CVE-2014-4342, included in 1.12.2 - drop patch for CVE-2014-4343, included in 1.12.2 - drop patch for CVE-2014-4344, included in 1.12.2 - drop patch for CVE-2014-4345, included in 1.12.2 - replace older proposed changes for ksu with backports of the changes after review and merging upstream (#1015559, #1026099, #1118347)- incorporate fix for MITKRB5-SA-2014-001 (CVE-2014-4345)- gssapi: pull in upstream fix for a possible NULL dereference in spnego (CVE-2014-4344)- gssapi: pull in proposed fix for a double free in initiators (David Woodhouse, CVE-2014-4343, #1117963)- fix license handling- pull in fix for denial of service by injection of malformed GSSAPI tokens (CVE-2014-4341, CVE-2014-4342, #1116181)- pull in changes from upstream which add processing of the contents of /etc/gss/mech.d/*.conf when loading GSS modules (#1102839)- pull in fix for building against tcl 8.6 (#1107061)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Backport fix for change password requests when using FAST (RT#7868)- spnego: pull in patch from master to restore preserving the OID of the mechanism the initiator requested when we have multiple OIDs for the same mechanism, so that we reply using the same mechanism OID and the initiator doesn't get confused (#1066000, RT#7858)- pull in patch from master to move the default directory which the KDC uses when computing the socket path for a local OTP daemon from the database directory x`X%L8e7$ue7? ? `d%* 6 \       P\    (89:GHI(X, YP \x]^bjd e f l t u v     \ p t      g h Ccpanel-perl-542-http-server-simple0.521.cp130~el8CPAN module - Lightweight HTTP serverCpanel build perl module 'HTTP::Server::Simple'Lightweight HTTP serverh&Mbh-centos-8.dev.cpanel.netlperlcpanel/perlhttps://metacpan.orglinuxnoarchTD $$$X޼Vb kVb k219c96a3b236d8b2754a84d5d9100f6d41e8ac473af75b52e8c67d49f4d82266cedf55cf3b30ed87598516a40ff44e6af976d70d7f9f5aeb1218fd449a5a0f2833e245d7c11f5e0c532c7a3fa4da9fc3056b9ddabe10f70cad28e4aaf2193538rootrootrootrootrootrootcpanel-perl-542-http-server-simple-0.52-1.cp130~el8.src.rpmcpanel-perl(HTTP::Server::Simple)cpanel-perl(HTTP::Server::Simple::CGI)cpanel-perl(HTTP::Server::Simple::CGI::Environment)cpanel-perl-542-http-server-simplecpanel-perl-542-http-server-simple-cgicpanel-perl-542-http-server-simple-cgi-environmentcpanel-perl-http-server-simplecpanel-perl-http-server-simple-cgicpanel-perl-http-server-simple-cgi-environment      cpanel-perl-542cpanel-perl-542-cgicpanel-perl-542-socketcpanel-perl-542-test-morerpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)1.943.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@YV<@Q+R@Busy Camels - 0.52-1.cp130Busy Camels - 0.52-1.cp108Busy Camels - 0.52-1.cp1198Todd Rinaldo - 0.52-1.cp1170Todd Rinaldo - 0.51-1.cp1156Todd Rinaldo - 0.44-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: HTTP-Server-Simple 0.52- Update from upstream: HTTP-Server-Simple 0.51- Update from upstream: HTTP-Server-Simple 0.440.52000.52-1.cp130~el8000.5200Simple.pmCGI.pmEnvironment.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/HTTP/Server//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/HTTP/Server/Simple//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/HTTP/Server/Simple/CGI/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-812ac88ac5533b4bc80f9c291001da806409548c42ac4a5e8051311f7ab8dd421?4Lh1ZaBk#1H3acf26ec2ec24f6b952301ea8f57ea94969ea4080a0954684f29edaa070c75d4c26355c428140214d70505c5559feefe66292dadj{po\j{U79bbeb13b3a4c1501j{{pj{{kXML document textdirectoryC++ source, ASCII textC++ source, UTF-8 Unicode textUTF-8 x~XpL@Q$message with its as_string method (Olivier Andrieu) - added dnf.i18n.ucd* functions as deprecated API (Jan Silhan) - i18n: unicode resulting translations (RhBug:1278031) (Jan Silhan) - po: get rid of new lines in translation (Jan Silhan) - output: add skip count to summary (RhBug:1264032) (Michal Domonkos) - groups: fix environment upgrade (Michal Luscon) - Fix plural strings extraction (RhBug:1209056) (Baurzhan Muftakhidinov) - po: fixed malformed beginning / ending (Jan Silhan) - zanata update (Jan Silhan) - cli: prevent tracebacks after C^ (RhBug:1274946) (Michal Luscon)- Update command_ref.rst (Jaroslav Mracek) - Change in automatic.conf email settings to prevent email error with default sender name (Jaroslav Mracek) - Replace assert_called() with assert_called_with() for Py35 support (Neal Gompa (ニール・ゴンパ)) - doc: improve documentation (Jaroslav Mracek) - doc: update the instructions related to nightly builds (Radek Holy) - Revert "Add the continuous integration script" (Radek Holy) - Revert "cosmetic: ci: fix the Copr name in the README" (Radek Holy) - Fix typo in Command.canonical's doctring (Timo Wilken) - base: group_install is able to exclude mandatory packages (Related:RhBug:1199868) (Jan Silhan)- don't import readline as it causes crashes in Anaconda (related:RhBug:1258364)- Revert "completion_helper: don't get IndexError (RhBug:1250038)"- add hawkey version requirement - revert commit #70956- doc: release notes 1.1.2 (Michal Luscon) - sanitize non Unicode command attributes (RhBug:1262082) (Jan Silhan) - don't redirect confirmation to stderr RhBug(1258364) (Vladan Kudlac) - clean: add rpmdb to usage (Vladan Kudlac) - completion_helper: don't get IndexError (RhBug:1250038) (Vladan Kudlac) - add --downloadonly switch (RhBug:1048433) (Adam Salih) - Add globbing support to base.by_provides() (RhBug:11259650) (Valentina Mukhamedzhanova) - spec: packaging python(3)-dnf according to new Fedora guidelines (RhBug:1260198) (Jaroslav Mracek) - Bug in Source0: URL in dnf.spec fixed (RhBug:126255) (Jaroslav Mracek) - To dnf.spec added provides dnf-command(command name) for 21 dnf commands (RhBug:1259657) (jmracek) - Expire repo cache on failed package download (Valentina Mukhamedzhanova) - cosmetic: ci: fix the Copr name in the README (Radek Holy) - Add the continuous integration script (Radek Holy) - Set proper charset on email in dnf-automatic (RhBug:1254982) (Valentina Mukhamedzhanova) - doc: improve configuration description (RhBug:1261766) (Michal Luscon) - remove: show from which repo a package is (Vladan Kudlac) - list: show from which repo a package is (RhBug:1234491) (Vladan Kudlac) - Spelling/grammar fixes (Ville Skyttä) - install: fix crash when terminal window is small (RhBug:1256531) (Vladan Kudlac) - install: mark unification of the progress bar (Vladan Kudlac) - fix translations in python3 (RhBug:1254687) (Michal Luscon) - group: CompsQuery now returns group ids (RhBug:1261656) (Michal Luscon)- fix access to demands (RhBug:1259194) (Jan Silhan) - make clean_requiremets_on_remove=True (RhBug:1260280) (Jan Silhan)- Fixed typo (RhBug:1249319) (Adam Salih) - fixed downgrade with wildcard (RhBug:1234763) (Adam Salih) - reorganize logic of get_best_selector(s) and query (RhBug:1242946) (Adam Salih) - completion_helper: don't crash if exception occurred (RhBug:1225225) (Igor Gnatenko) - base: expire cache if repo is not available (Michal Luscon) - Don't suggest --allowerasing if it is enabled (Christian Stadelmann) - translation works in python3 (RhBug:1254687) (Jan Silhan) - logrotate less often (RhBug:1247766) (Jan Silhan) - implement dnf mark command (RhBug:1125925) (Michal Luscon) - groups: use comps data to migrate persistor (Michal Luscon) - groups: preserve api compatibility (Michal Luscon) - groups: use persistor data for removing env/group (Michal Luscon) - persistor: add migration and bump version (Michal Luscon) - persistor: store name and ui_name of group (Michal Luscon) - show real metadata timestamp on the server in verbose mxPnXLI@[9$$999nalin@redhat.com> 1.6.1-3Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai 1.6.1-2Nalin Dahyabhai 1.6.1-1Nalin Dahyabhai Nalin Dahyabhai 1.6-6Nalin Dahyabhai 1.6-5Nalin Dahyabhai 1.6-4Nalin Dahyabhai Nalin Dahyabhai 1.5-24Nalin Dahyabhai 1.6-3Nalin Dahyabhai Nalin Dahyabhai 1.6-2Nalin Dahyabhai 1.5-23Nalin Dahyabhai 1.5-22Nalin Dahyabhai Nalin Dahyabhai - 1.5-20Nalin Dahyabhai Nalin Dahyabhai 1.6-1Nalin Dahyabhai Nalin Dahyabhai - 1.5-18Nalin Dahyabhai - 1.5-17Nalin Dahyabhai - 1.5-16Nalin Dahyabhai - 1.5-14Nalin Dahyabhai - 1.5-12Nalin Dahyabhai Nalin Dahyabhai - 1.5-11Nalin Dahyabhai - 1.5-10Nalin Dahyabhai - 1.5-9.pal_18695Nalin Dahyabhai - 1.5-9Nalin Dahyabhai - 1.5-8Nalin Dahyabhai - 1.5-7Nalin Dahyabhai - 1.5-6Nalin Dahyabhai - 1.5-5Nalin Dahyabhai - 1.5-4Nalin Dahyabhai - 1.5-3Nalin Dahyabhai - 1.5-2Nalin Dahyabhai - 1.5-1.2Jesse Keating - 1.5-1.1Nalin Dahyabhai 1.5-1Nalin Dahyabhai 1.5-0Nalin Dahyabhai 1.4.3-9Nalin Dahyabhai 1.4.3-8Nalin Dahyabhai 1.4.3-7Nalin Dahyabhai 1.4.3-6Stepan Kasal 1.4.3-5Jesse Keating 1.4.3-4.1Nalin Dahyabhai 1.4.3-4Nalin Dahyabhai 1.4.3-3Matthias Clasen 1.4.3-2Jesse Keating Nalin Dahyabhai Nalin Dahyabhai 1.4.3-1Nalin Dahyabhai 1.4.2-4Nalin Dahyabhai 1.4.2-3Nalin Dahyabhai 1.4.2-2Nalin Dahyabhai 1.4.2-1Nalin Dahyabhai 1.4.1-6Nalin Dahyabhai 1.4.1-5Nalin Dahyabhai Nalin Dahyabhai 1.4.1-4Nalin Dahyabhai 1.4.1-3Martin Stransky 1.4.1-2Nalin Dahyabhai 1.4.1-1Nalin Dahyabhai 1.4-3Nalin Dahyabhai Nalin Dahyabhai 1.4-2Nalin Dahyabhai 1.4-1Nalin Dahyabhai 1.3.6-3Nalin Dahyabhai 1.3.6-2Nalin Dahyabhai 1.3.6-1Nalin Dahyabhai 1.3.5-8Martin Stransky 1.3.5-7Nalin Dahyabhai 1.3.5-6Nalin Dahyabhai 1.3.5-3Nalin Dahyabhai Nalin Dahyabhai 1.3.5-2Nalin Dahyabhai 1.3.5-1Nalin Dahyabhai Nalin Dahyabhai 1.3.4-7Nalin Dahyabhai 1.3.4-6Nalin Dahyabhai 1.3.4-5Nalin Dahyabhai 1.3.4-4Nalin Dahyabhai 1.3.4-3Nalin Dahyabhai 1.3.4-2Elliot Lee Nalin Dahyabhai 1.3.4-0.1Nalin Dahyabhai 1.3.4-0Nalin Dahyabhai 1.3.3-8Nalin Dahyabhai 1.3.3-7Nalin Dahyabhai 1.3.3-6Nalin Dahyabhai 1.3.3-5Nalin Dahyabhai 1.3.3-4Thomas Woerner 1.3.3-3Nalin Dahyabhai 1.3.3-2Nalin Dahyabhai 1.3.3-1x]XgLXw$gwvxs from module (RhBug:1569068)- [history] Fix 'attempt to write a readonly database' error in addConsoleOutputLine(). - [spec] Improve YUM v3 compat layer. - [doc] document missing link from yum-rhn-plugin to dnf-plugin-spacewalk (RhBug:1580356) - [doc] document difference between yum and dnf when listing packages (RhBug:1615834) - [doc] document missing download functionality after transaction table is displayed (RhBug:1585140) - [systemd] dnf-makecache.timer: move the ordering after network to .service - [translations] Update translations from zanata. - [cli] Fix 'already installed' message output. - [module] change 'module_nsvp' to 'module_spec' - [module] show module profiles without ', ...' - [module] unify usability of RepoModuleDict.get_info*(); fix traceback - [security] fix update count (RhBug:1585138) - [cli] enable reposync to use --destdir (RhBug:1582152) - [repo] Replace dnf.repo.Repo with libdnf implementation. - [dnf] Limit DeprecationWarning to dnf.* modules only.- [misc] Fallback to os.getuid() if /proc/self/loginuid can't be read (RhBug:1597005) - [translations] Update translations from zanata. - [doc] Update module documentation. - [module] Fix `module provides` output. - [module] Add `module reset` command. - [module] Fix module disable command - [repo] Improve error message on broken repo (RhBug:1595796) - [doc] Enhance a command documentation (RhBug:1361617) - [module] Automatically save module persistor in do_transaction(). - [drpm] Fixed setting deltarpm_percentage=0 to switch drpm off - [repo] Split base.download_packages into two functions - [output] Use libdnf wrapper for smartcols - [conf] Do not traceback on empty option (RhBug:1613577)- [sack] Use module_platform_id option. - [module] Switch module persistor to libdnf implementation. - [module] Auto-enable module streams based on installed RPMs. - [transaction] Fix: show packages from the current transaction. - [conf] Convert any VectorString type to list. - [module] Replace 'enabled' config option with 'state'. - [install_specs] Do not exclude groups' packages - [module] Use module sack filtering from libdnf - [module] Many UX fixes.- [module] Move 'hotfixes' conf option to libdnf and rename it to 'module_hotfixes'. - [goal] Exclude @System repo packages from distro_sync. - [conf] Setup configuration values using C++ bindings. - [module] Drop module lock command. - [crypto] Use handle from repo in dnf.crypto.retrieve(). - [module] Assume a 'default' profile exists for all modules (RhBug:1568165) - [base] Introduce easy installation of package, group and module specs.- [transaction] Fix 'TransactionItem not found for key' error. - [module] Allow removing module profile without specifying a stream. - [module] Fix 'BaseCli' object has no attribute '_yumdb' error. - [callback] Fix TransactionDisplay.PKG_ERASE redirect to a non-existing constant. - [spec] Change yum compat package version to 4.0.version. - [cache] Clean transaction temp files after successfull transaction - [log] Log messages from libdnf logger - [transaction] Add states to report rpm transaction progress - [transaction] Cache TransactionItem during handling of RPM callback (RhBug:1599597) - [systemd] dnf-makecache.timer: move to multi-user to fix loop- Bug fix release- Update to 3.0.2-1- Update to 3.0.1-1 - Support of MODULES - new DNF command `module` - Add attribute dnf.conf.Conf.proxy_auth_method - New repoquery option `--depends` and `--whatdepends` - Enhanced support of variables - Enhanced documentation - Resolves: rhbz#1565599 - Resolves: rhbz#1508839 - Resolves: rhbz#1506486 - Resolves: rhbz#1506475 - Resolves: rhbz#1505577 - Resolves: rhbz#1505574 - Resolves: rhbz#1505573 - Resolves: rhbz#1480481 - Resolves: rhbz#1496732 - Resolves: rhbz#1497272 - Resolves: rhbz#1488100 - Resolves: rhbz#1488086 - Resolves: rhbz#1488112 - Resolves: rhbz#1488105 - Resolves: rhbz#1488089 - Resolves: rhbz#1488092 - Resolves: rhbz#1486839 - Resolves: rhbz#1486839 - Resolves: rhbz#1486827 - Resolves: rhbz#1486816 - Resolves: rhbz#1565647 - Resolves: rhbz#1583x@MX9L(48$$4838F8(?3Hd . i &3 7Mhnx              6d < p  ( 8 Y9 tY:YF+G+ H,( I,\ X,lY,\-, ]-` ^.8b.c0Ad0e0f0l0t0 u0 v1z22233D3X3\5t 5 7788 8g8 h8$Cea-php72-php-mysqlnd7.2.3412.14.15.cpanelEOL A module for PHP applications that use MySQL databasesscl-php72 has reached End of Life. The ea-php72-php-mysqlnd package contains a dynamic shared object that will add MySQL database support to PHP. MySQL is an object-relational database management system. PHP is an HTML-embeddable scripting language. If you need MySQL support for PHP applications, you will need to install this package and the php package. This package use the MySQL Native Driverjhou-2 EA4-production / CentOS_8cPanel, Inc.PHPDevelopment/Languageshttps://endoflife.date/phplinuxx86_6475; DGEAAAAjMjMjMjpjpjpjjjjjjjbb952e36d48100266b812a6a02aac31f63334c541014003759c01a7688bd499867bd20ff7bf47cf9c13ea5fbccc5baf2c3e4a7115842a13f94a4841695772d11c9a95cb87ee57562d5c46b9fed14ade55a7e23583bd1b24a7aaf73eaaeee805abca8c5ee8beaed3862c9de94786de0c2d98bd5f42bbd512640f3ce1de5f8df7cd075a4a3958d0819dfa9f485fc87e90159debfe24419d1a81305c34a4a75111953776ce3f4e7539bcaad25d0f695aaa94d1382f494c09eb5536df5cee0555d41../../../../opt/cpanel/ea-php72/root/usr/lib64/php/modules/mysqli.so../../../../opt/cpanel/ea-php72/root/usr/lib64/php/modules/pdo_mysql.so../../../../opt/cpanel/ea-php72/root/usr/lib64/php/modules/mysqlnd.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootea-php72-php-7.2.34-12.14.15.cpanel.src.rpmconfig(ea-php72-php-mysqlnd)ea-php72-php-mysqlea-php72-php-mysqliea-php72-php-mysqlndea-php72-php-mysqlnd(x86-64)ea-php72-php-pdo_mysqlea-php72-php_database@@@@@@    @config(ea-php72-php-mysqlnd)ea-php72-php-pdolibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)7.2.34-12.14.15.cpanel7.2.34-12.14.15.cpanel3.0.4-14.6.0-14.0-15.2-14.14.3iC@hR@f)@e\d,@b\@`ٹ`B@___]@_u_R,@_+_@_^^@^2^@^|@^s^^[^Nt^=Q@^)]f@]]]|@]@]]z3@]nU]B@]5@]#0@];] \@\s@\\@\\\\M\\\\P@@\J@\73\ @[%@[[;@[Q@[y[[U@[P}@[0@[{@[Z@Z3@ZԐ@Z@ZZZ@ZtRZaZX@ZWQZTZOhZ'Z%8Z@ZNYYB@Y@YYdY*@Y@YYBrian Mendoza - 7.2.34-12Chris Castillo - 7.2.34-11Julian Brown - 7.2.34-10Tim Mullin - 7.2.34-9Julian Brown - 7.2.34-8Travis Holloway x<X;Li$>W"?xyN+ץ_u48`; ?),L2O1硰 3uIGme),h(S\~2G@dc1a1(P]Ϳ9P>-RvvwG`7 Qd~R 'I]5JԞ0:`ū|}gQRR`8u1&=N~>9@&ò Lfh8! )%JLP #Ӣb3H~'m" KL%c dA{ ؁7Mƻӳ/$ux9PT-覝N%KQkZYJcmgo~qƥ ?PnF&n7}W^t׷5b#6w{xG{O бe.@opRPͷѿ &+źp气p#!vUč0=2xơe[Ϫ2qHlELd˿[K< w4Xd238b4d6f6e4d88a589e9c889493a9fadbd36b81bd827f7adee2494b67138a5b003a10c426c67d034cc0ad21d8d15a168a6ea539j{xPj{x - 1.0.0-0Fedora Release Engineering - 0.1.0-2Paul Moore - 0.1.0-1Paul Moore - 0.1.0-0- rebase to 2.5.2 resolves: rhbz#2019893- rebase to 2.5.1 resolves: rhbz#1927635- rebase to upstream version 2.4.3 resolves: rhbz#1770693 resolves: rhbz#1768583- rebase to 2.4.1- spec: make the check phase conditional- Honor %{valgrind_arches}- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- New upstream version- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Re-enable valgrind-based tests on ARMv7- Disable running valgrind-based tests on ARMv7 due to glibc/valgrind bug (RHBZ #1466017)- New upstream version- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Cleanup the changelog whitespace and escape the macros to make rpmlint happy- New upstream version- No valgrind on s390- New upstream version- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- New upstream version- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- New upstream version- New upstream version - Added aarch64 support - Added a static build- Fully builds on i686, x86_64, and armv7hl (RHBZ #1106071)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Build with CFLAGS="${optflags}"- Removed the kernel dependency (RHBZ #1065572)- New upstream version - Added a %check procedure for self-test during build- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- New upstream version - Added support for the ARM architecture - Added the scmp_sys_resolver tool- New upstream version- New upstream version with several important fixes- New upstream version - Remove verbose build patch as it is no longer needed - Enable _smp_mflags during build stage- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Limit package to x86/x86_64 platforms (RHBZ #837888)- Initial version/sbin/ldconfig/sbin/ldconfig 2.5.2-1.el82.5.2-1.el8.build-id2ee372e27494eeffec6b1a37f23fa506aa0e4962libseccomp.so.2libseccomp.so.2.5.2libseccompCHANGELOGCREDITSREADME.mdlibseccompLICENSE/usr/lib//usr/lib/.build-id//usr/lib/.build-id/2e//usr/lib64//usr/share/doc//usr/share/doc/libseccomp//usr/share/licenses//usr/share/licenses/libseccomp/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2ee372e27494eeffec6b1a37f23fa506aa0e4962, strippedASCII textUTF-8 Unicode textx+XCLT$?TTD&?!d / Y  MYrx    ( 0Pxw(89:#(GHIXY\]^hbd e f l t!u!(v!H!`!d!j!!!6# $ 6 &@&i&&&g&h&Cfirewalld-filesystem0.9.1112.el8_10.alma.1Firewalld directory layout and rpm macrosThis package provides directories and rpm macros which are required by other packages that add firewalld configuration files.jYs390x-builder01.almalinux.orgAlmaLinuxAlmaLinuxGPLv2+AlmaLinux Packaging Team Unspecifiedhttp://www.firewalld.orglinuxnoarchAAAAAAA큤jYjYjYjYjYjYjYjY9877097fdb22d97ce054038f5c0ea9966f1472e5b006d3274c20b96ed8dfea27rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootfirewalld-0.9.11-12.el8_10.alma.1.src.rpmfirewalld-filesystem    rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.3jI@jhi@g@f@fj@fj@fj@fj@eDeDeDd>@aap@a@a@a@a@`@`@`````7@```_@_)M^^W@^8 @]ʞ]d@]R@]Ik]6]:]@\;(@\4\@\I[[[;@[\[ug@[r@[m~@[l,[CN@[?YZVZI@ZI@Z@Z}@Zz@Zz@ZOhZ6\@YYx@Y:XX+X@X@XOXEVX@X#X=W@W@WzOWs@WrfWL+@W0{Wo@WV@V@VVHVA@UU@UUa@Ua@UUzUzUKSU/@U@U@T@T@TLT=@S@S%@SSR@S@SSSR'R@RR@RxR_@RNRM\@RL RIgQQQ@QyQ@Q@QnQT0QIQ8@Q$Q@P@P@P@P @PpP~PIP3x@P(@P!@OOOc+@OaOU@OTOC@O1@O/MY@M!@M!@ME@Andrew Lukoshko - 0.9.11-12.alma.1Eric Garver - 0.9.11-12Eric Garver - 0.9.11-11Eric Garver - 0.9.11-10Eric Garver - 0.9.11-9Eric Garver - 0.9.11-8Eric Garver - 0.9.11-7Eric Garver - 0.9.11-6Eric Garver - 0.9.11-5Eric Garver - 0.9.11-4Eric Garver - 0.9.11-3Eric Garver - 0.9.11-2Eric Garver - 0.9.11-1Eric Garver - 0.9.3-13Eric Garver - 0.9.3-12Eric Garver - 0.9.3-11Eric Garver - 0.9.3-10Eric Garver - 0.9.3-9Eric Garver - 0.9.3-8Eric Garver - 0.9.3-7Eric Garver - 0.9.3-6Eric Garver - 0.9.3-5Eric Garver - 0.9.3-4Eric Garver - 0.9.3-3Eric Garver - 0.9.3-2Eric Garver - 0.9.3-1Eric Garver - 0.8.2-6Eric Garver - 0.8.2-5Eric Garver - 0.8.2-4Eric Garver - 0.8.2-3Eric Garver - 0.8.2-2Eric Garver - 0.8.2-1Eric xhX L2\D$L\D]DD`?d  F R^o`o  >o  o o iGo jopowo~oG(c8l>9d>:">GoHtoI0oXY\o]o^ FbTdefltouͬovh $(  v؟oTgXh\Cxkeyboard-config2.281.el8X Keyboard Extension configuration dataThis package contains configuration data used by the X Keyboard Extension (XKB), which allows selection of keyboard layouts when using a graphical interface.^C(build.cloudlinux.comVCloudLinuxCloudLinuxMITCloudLinux Packaging Team Unspecifiedhttp://www.freedesktop.org/wiki/Software/XKeyboardConfiglinuxnoarchalt mT2TOP*peQCd_1?8p;(:a ZMo&/gR  I/D"k Jr c ! [f0[Y (lR41FA  T cY^{W 7V *3e( >u_O'#2 58. NZ4O5?rZ097E_!}\ F@79- BJE0 J-R yF %|R  O# @O6~.;=m  U(Pc2+<B*9g L uJ> A iICgJt((3B>  e>Hy;@=_= . $]6[[]ZnC-U8U-7qBLIg6'>L5)cuZ+b GKC8fJc_>Hs,AAA큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤x XL`D$DDCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m32 -march=x86-64 -mtune=generic -mfpmath=sse -mstackrealign -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnudirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Perl5 module source textPRRRRRRutf-88eda45ac4e6fb5570852d45383fd16a5538674932dbf1b2ef86b073696f7a80f?`) Qd~qY yl"KL/:Ȳb(MvF txiq%z41;b峈ݮ=ÿ~s%PAߚHE=  ,dk3}P=#/~|φF>{kT"$b_[AVy+E5]2P}v-kPjf`M_>ItAl)wggg`}[_rT{%l:@ &BǒMݖЁ\fMߔm^W8? vf Lii)"IHJAzKc1: pB1P(N%y G8(-7qܠ\R*H9Hbn7V@L%Dx^%Wp`) Qd~3 d\ENUˊ>٩0d WIE 2Y/ίMھ6LhļӃq;qCLͳ4T^eT"]_ fsŵQgv0؊mLZoؚ~dJg5X+pJnciZkj;:UstjVC/Vk.k~$^^Q\gEL9\ v)*mJDQ7URR~}@ jHK~TܽpHFCV.J ž2]ؾ%D <>"Pnc=;,BQ qޫ= FIKR❮ T8924ce0d65eed39e3db694b4c8d730b4f5c7bf7478719c2c177495399cf7b073241abf84f2b230d39d65d8a58b8bc590e370747bj{xj{xist.jsr,l , plist.php.list.pyoSQ6Q"listLoadBalancerRules_default.jsonesnQ6n*listLoadBalancerRuleInstances_default.jsonQQ1j*listAvailableProductTypes_notemplates.jsonQQ1l%listAvailableProductTypes_nodisk.jsonQ1P&listAvailableProductTypes_default.json{Q.llistSecurityGroups_default.json.cQ.ylistSSHKeyPairs_no_keys.json_Q.p)listSSHKeyPairs_get_one_doesnt_exist.jsonQ.ylistSSHKeyPairs_get_one.json-Q.)listSSHKeyPairs_default.json)Q~.llistRouters_default.jsonSQ}..listResourceLimits_default.jsonitQ|.'listPublicIpAddresses_firewallicmp.jsonlQ{.Q1y"listPublicIpAddresses_default.jsonQz.listProjects_default.jsonQy.Q1a$listPortForwardingRules_default.json_Qx.nlistOsTypes_default.jsoneQw.glistNics_default.jsonQv.vlistNetworks_stoppedvm.jsonpyQu.glistNetworks_rootdisksize.jsonjecQt.4 listNetworks_deploynetworks.jsonlQs.wlistNetworks_deployip.jsonQr.llistNetworks_deployfail2.jsonQq.elistNetworks_deployfail.json{Qp.llistNetworks_default.jsonQo.6!listNetworkOfferings_default.jsonQn.tlistNetworkACLs_default.jsoniQm.l listNetworkACLLists_default.jsonuQl.Q1g"listIpForwardingRules_default.json9Qk.l#listFirewallRules_firewallicmp.jsonlQj.vlistFirewallRules_default.jsonhivQi.$listEgressFirewallRules_default.jsoneQh.f%listDiskOfferings_withvolumetype.jsonQg.])listDiskOfferings_withcustomdisksize.jsonQf.llistDiskOfferings_default.jsonWQe.ylistAffinityGroups_default.jsonpyQd.#listAffinityGroupTypes_default.jsonQ="list.pyi.K glist.pyct`2YwJ 'QiQOM_list.pyom()e1T*list.hlQXQOlist.cpython-39.pycZwelist.cpython-36.pyc -wclist.cpython-36.opt-1.pyc . list.1ssl.gzllist-unordered.svglist-settings-line.svgxXLQ`O$p`OaO_O type (RFC 8777). - added Net_DNS2_RR::asArray(), which returns the same values as __toString(), but as an array for easier access. - added Net_DNS2::closeSockets(), which lets you close all cached network sockets in the resolver object. - added Net_DNS2::getSockets(), which returns the local sockets cache array. - added date_created and date_last_used to the Net_DNS2_Socket object, to track usage stats on each socket object. - added the SHA256, SHA384, and GOST digest defines to Lookups.php. - dropped the Net_DNS2_Socket_Sockets, and switch to just using the streams code. There's no speed difference anymore. - fixed a bug in Net_DNS2_Packet::compress() and Net_DNS2_Packet::expand() related to dot literals in compressed names. - fixed a display issue in the IPSECKEY RR when displaying hostname / domain names in the gateway field. - fixed a couple inconsistencies in the docs. - fixed a PHP 7.4 bug in Sockets.php; accessing a null value as an array throws an exception now. - fixed Net_DNS2_RR_DS so it will be able to support other digest definitions without any other changes. - the Net_DNS2_RR_NIMLOC class was incorrectly named Net_DNS2_RR_NIMLOCK. - Net_DNS2_PrivateKey was using the wrong member variable name for the key_format value. - changed all references to array() to []. - removed all sorts of license noise from the files. - updated the test cases to use PHPUnit v9+.- bugfix when returning an empty bitmap-type in BitMap.php - patch from BugMaster510945. - added the BIND 9 private record RR (TYPE65534) - patch from BugMaster510945. - added DNSSEC algorithms 13-16 (ECDSAP256SHA256, ECDSAP384SHA384, ED25519, and ED448). - added SSHFP algoritm ED25519. - modified Net_DNS2::sendPacket() to use current()/next() rather than the deprecated each() (deprecated in 7.2).- fixed an issue when looking up . or com., when using the strict_query_mode flag. - fixed a bug in the caching logic where I was loading the content more than once per instance, when really I only need to do it once. - changed the Net_DNS2::sock array to use the SOCK_DGRAM and SOCK_STREAM defines, rather than the strings 'tcp' or 'udp'. - fixed a bug in the Net_DNS2_Header and Net_DNS2_Question classes, where I was using the wrong bit-shift operators when parsing some of the values. This only became apparent when somebody was trying to use the CAA class (id 257); it was causing this to roll over to the next 8 bit value, and returning 1 (RR A) instead of the CAA class. - fixed a bug that occurs when a DNS lookup request times out, and then the same class is reused for a subsequent request. Because I'm caching the sockets, the timed out data could eventually come in, and end up being seen as the result for a subsequent lookup. - fixed a couple cases in NSAP.php where I was comparing a string to to an integer.- changed the role for the README.md file to doc - parse the resolv.conf options line; right now I just support the timeout and rotate options. - the options values only work if you set the new option use_resolv_options to true; this is to keep backwards compatibility. - added support for RFC 6594; support for SHA-256 and ECDSA in the SSHFP resource record. - added the SMIMEA resource record; this just extends the TLSA record. - added the AVC resource records; this just extends the TXT record. - added error and EDNS0 defines for DNS Cookies (RFC7873) - added EDNS0 defines to the lookup class - dropped the Net_DNS2_Packet::formatIPv6() function; this was deprecated in v1.1.3 - re-wrote the Net_DNS2::expandIPv6() function. Based on testing, the new version is about twice as fast.- increased the default DNSSEC payload size value to 4000 bytes per RFC 4035 section 4.1; this is still configurable. - fixed a bug where I was still using the DNS_MAX_UDP_SIZE default (512 bytes) for all requests, event DNSSEC, where I should have been using the dnssec_payload_size config value. - removed the limitation that PTR records had to look like IP addresses; you can add other things to PTR records, like service discovery objects- RFC 6763. - droppxXL@J:9$*:99923ed8d5231478b557c1163e76?k83!^P,*%f[y *%}F62W}{\VaO}aVrNn> ;YNLZߗ<[/Pӏ eD5hdj.$0<($ $$.oWmg~ N øG:+e7̘@D$e #wV/[og\ }0- 1Tr' ngbB*Hj,n ܑ5ok50/'_#C's?(OMVJ,AsXx /wpo,K'.vWmY7$X(~:3!^P,*%f[y *% Ud>&Vm>W== oWNne/ÏZ'_Qb懼Z*a`goE6xɽ)R\\`BX;/FZ%Ɇna4hA"Ȍ.0\0ytGz7ǵ L1wkqNlPT_C T ;|4tFC.L, u1RKt8t+TB*NYUQLש}lUC,C_hYyb,_Rh`>&# qd>+O] jE#V^vE`REEզp}&hO@:p,*\!^&ǮH}[ڸ6qJ)<1{~n`LP* ծ-lbIfRSBi"\jPQʉGg6Oc'`ZNzMo(:v j t }  zG!0U Rs!/usr/share/locale/ca/LC_MESSAGES/cl/usr/share/locale/ca/b/usr/share/locale/ca.us-ascii/Gl"/usr/share/locale/byn/LC_MESSAGES/Resa/usr/share/locale/byn/`/usr/share/locale/bug/_/usr/share/locale/bua/^/usr/share/locale/btk/]/usr/share/locale/bs_BA/`#+ %') G 0Tt!/usr/share/locale/bs/LC_MESSAGES/\/usr/share/locale/bs/[/usr/share/locale/brx/Z/usr/share/locale/bra/0"&G0RQr!/usr/share/locale/br/LC_MESSAGES/Y/usr/share/locale/br/X/usr/share/locale/bo/W/usr/share/locale/bnt/p!+ $%")G0P$/usr/share/locale/bn_IN/LC_MESSAGES/V/usr/share/locale/bn_IN/U/usr/share/locale/bn_BD/X + #$)G0Oa!/usr/share/locale/bn/LC_MESSAGES/T/usr/share/locale/bn/S/usr/share/locale/bm/R/usr/share/locale/bla/Q/usr/share/locale/bin/P/usr/share/locale/bik/Ge!/usr/share/locale/bi/LC_MESSAGES/O/usr/share/locale/bi/N/usr/share/locale/bho/M/usr/share/locale/bh/Lp/usr/share/locale/bg_BG/ia/usr/share/locale/bg/LC_TIME/xxXL{H$gHHdora_23_Mass_Rebuild- Added upstream patch to fix settimeout() bug (#1220171)- Fix broken release tag- Rebuild for new lua- lua 5.3- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- build -compat subpackage against compat-lua- Add -devel package.- update to the 3.0rc1 from git- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- update to 2.1rc1 from git- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Build support for Unix domain sockets (rhbz: #720692)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Pass proper CFLAGS to produce valid debuginfo - Pass LICENSE file through iconv to produce proper UTF8- Initial package  !"#$%&'()*+,-.3.0-0.17.rc1.el83.0-0.17.rc1.el8 .build-id260413d6f9b252c3eabd5c4cf80e2c62f98667f42bfd91d1c84461417cf3e64f534edd3c9a55c1bd92bc4303fa94b5505087ff544213954a99eeb485ed549e30f69bdbc5238c3ce59e8babb7e60f6c21mimecore.sosocketcore.soserial.sounix.solua-socketREADMEdns.htmlftp.htmlhttp.htmlindex.htmlinstallation.htmlintroduction.htmlltn12.htmllua05.pptluasocket.pngmime.htmlreference.cssreference.htmlsmtp.htmlsocket.htmltcp.htmludp.htmlurl.htmllua-socketLICENSEltn12.luamime.luasocketsocket.luaftp.luaheaders.luahttp.luasmtp.luatp.luaurl.lua/usr/lib//usr/lib/.build-id//usr/lib/.build-id/26//usr/lib/.build-id/2b//usr/lib/.build-id/92//usr/lib/.build-id/ed//usr/lib64/lua/5.3//usr/lib64/lua/5.3/mime//usr/lib64/lua/5.3/socket//usr/share/doc//usr/share/doc/lua-socket//usr/share/licenses//usr/share/licenses/lua-socket//usr/share/lua/5.3//usr/share/lua/5.3/socket/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu  directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ed549e30f69bdbc5238c3ce59e8babb7e60f6c21, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2bfd91d1c84461417cf3e64f534edd3c9a55c1bd, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=92bc4303fa94b5505087ff544213954a99eeb485, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=260413d6f9b252c3eabd5c4cf80e2c62f98667f4, strippedASCII textHTML document, ASCII textPNG image data, 128 x 128, 8-bit/color RGB, non-interlacedHTML document, ISO-8859 textUTF-8 Unicode textxXLLT$(TTTode optimizations- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- bump versions on old config package obsoletes (f21 is on 0.3.14 now)- Require python3-gobject-base for fedora >= 23 and rhel >= 8 (RHBZ#1242076) - Fix rhel defines: No python3 for rhel-7- Fixed 'pid_file' referenced before assignment (RHBZ#1233232)- reunification of the firewalld spec files for all Fedora releases - fix dependencies for -applet and -config: use_python3 is the proper switch not with_python3 (RHBZ#1232493) - firewalld.spec: - fixed requirements for -applet and -config - man pages: - adapted firewall-applet man page to new version - firewall-applet: - Only honour active connections for zone changes - Change QSettings path and file names - firewall-config: - Only honour active connections for zone changes in the “Change Zones of Connections” menu - Translations: - updated translations - marked translations for “Connections” for review- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Fix issue with missing polkit policy when installing firewalld on Cloud Edition.- firewall-applet - do not use isSystemTrayAvailable check to fix KDE5 startup - dropped gtk applet remain: org.fedoraproject.FirewallApplet.gschema.xml- renamed python2-firewall to python-firewall - fixed requirements for GUI parts with Python3 - dropped upstream merged python3 patch - firewalld: - print real zone names in error messages - iptables 1.4.21 does not accept limits of 1/day, minimum is 2/day now - rate limit fix for rich rules - fix readdition of removed permanent direct settings - adaption of the polkit domains to use PK_ACTION_DIRECT_INFO - fixed two minor Python3 issues in firewall.core.io.direct - fixed use of fallback configuration values - fixed use without firewalld.conf - firewalld main restructureization - IPv6_rpfilter now also available as a property on D-Bus in the config interface - fixed wait option use for ipXtables - added --concurrent support for ebtables - richLanguage: allow masquerading with destination - richLanguage: limit masquerading forward rule to new connections - ipXtables: No dns lookups in available_tables and _detect_wait_option - full ebtables support: start, stop, reload, panic mode, direct chains and rules - fix for reload with direct rules - fix or flaws found by landscape.io - pid file handling fixes in case of pid file removal - fix for client issue in case of a dbus NoReply error - configuration - new services: dropbox-lansync, ptp - new icmptypes: timestamp-request, timestamp-reply - man pages: - firewalld.zones(5): fixed typos - firewalld.conf(5): Fixed wrong reference to firewalld.lockdown-whitelist page - firewall-applet: - new version using Qt4 fixing several issues with the Gtk version - spec file: - enabled Python3 support: new backends python-firewall and python3-firewall - some cleanup - git: - migrated to github - translations: - migrated to zanata - build environment: - no need for autoconf-2.69, 2.68 is sufficient- Use VARIANT_ID instead of VARIANT for making decisions- Switch to using $VARIANT directly from /etc/os-release- Fix bugs with posttrans - Remove nonexistent fedora-cloud.conf symlink- Remove per-edition config files - Decide on default configuration based on /etc/os-release- use python3 bindings on fedora >=23- enable python2 and python3 bindings for fedora >= 20 and rhel >= 7 - use python3 bindings on fedora >= 22 and rhel >= 8 for firewalld, firewall-config and firewall-applet- firewalld: - ipXtables: use -w or -w2 if supported (RHBZ#1161745, RHBZ#1151067) - DROP INVALID packets (RHBZ#1169837) - don't use ipv6header for protocol matching. (RHBZ#1065565) - removeAllPassthroughs(): remove passthroughs in reverse order (RHBZ#1167100) - fix config.service.removeDestination() (RHBZ#1164584) - firewall-config: - portProtoDialog: other protocol excludes port number/range - better fix for updating zoneStore also in update_active_zones() -x8XLp;$ ;;d mpletion/completions//usr/share/doc/stunnel//usr/share/licenses//usr/share/licenses/stunnel//usr/share/man/man8//usr/share/man/pl/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c7778b876c3bd2e35bdc2eddbe032aab78fc5cf1, strippedASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b6fb45613272271dd1f43a2976bafa4060c919cb, strippedHTML document, ASCII text, with CRLF line terminatorsHTML document, ISO-8859 textUTF-8 Unicode (with BOM) textUTF-8 Unicode texttroff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)RRR RRR R RRRRRRRRR RR RRRRRRRRRRRRRutf-87ad50badddf09753d34ee140307f3474c9036f54f1e38977a5ac39eba47442ae?3!^P,*%f] *%KnZFU1£1Q-0=P7פV n5x%g9t迕@czp딗vl 3b8SZ :ufRȃbFTj@h-f8q9K#hsq]Բ?$axH,w /O}afF.ES4U"ws_Eᩘc,DnV߷ =uIꏍ&+o+KJ@v+&mCQnAbQaP?}xVVuZF  Iӵ o # I䵲(#}kLOT n[R3_ pmb6 r_}J^L Ll|PER;3!^P,*%f] *%~E;JA,+; v,-\␓9)sL6"ȣL9bPڀF7)<1PsB 8DI"x%FyH4 3rw B6īRJj#j/b:t-E1פM$k#hb? ZEQQw!Xs+AHr(zZix *Pfu%[ɲHT`OFvknt*ೄ$t_ һQ T}9XfYY>\;|2 *%*CwY?g})Fܽ?9"l8c"`NfPLᔐ!`a pV:VgJhn ʨnX,^JLLJa*/yR?"q̖.9jO#<`rLʐ 1%o {0"z$74bc88f4ca6951896b058499a990273a05b6c56e4058f417b8ae41d8ee6eb502e44a4799136a6a753473d2e74007e5c8b4c9743162j{yoTj{x83e36a3fba8957837882ddbc20a0c03610114ee789058176858d7188988796627db690e3fcfbeb6fd18177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643almalinux-release../usr/lib/os-releasealmalinux-releasealmalinux-releasealmalinux-releasealmalinux-releaserootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootalmalinux-release-8.10-1.el8.src.rpmxXLp$ sh 2.0.29-2Dan Walsh 2.0.29-1Dan Walsh 2.0.28-1Dan Walsh 2.0.27-7Dan Walsh 2.0.27-6Dan Walsh 2.0.27-5Dan Walsh 2.0.27-4Dan Walsh 2.0.27-3Dan Walsh 2.0.27-1Dan Walsh 2.0.26-3Dan Walsh 2.0.26-2Dan Walsh 2.0.26-1Dan Walsh 2.0.25-15Dan Walsh 2.0.25-14Dan Walsh 2.0.25-13Dan Walsh 2.0.25-12Dan Walsh 2.0.25-11Dan Walsh 2.0.25-10Dan Walsh 2.0.25-9Dan Walsh 2.0.25-8Dan Walsh 2.0.25-7Dan Walsh 2.0.25-6Dan Walsh 2.0.25-5Dan Walsh 2.0.25-4Dan Walsh 2.0.25-3Dan Walsh 2.0.25-2Dan Walsh 2.0.25-1Dan Walsh 2.0.23-2Dan Walsh 2.0.23-1Dan Walsh 2.0.22-13Dan Walsh 2.0.22-11Dan Walsh 2.0.22-10Jeremy Katz - 2.0.22-9Dan Walsh 2.0.22-8Dan Walsh 2.0.22-7Dan Walsh 2.0.22-6Dan Walsh 2.0.22-5Dan Walsh 2.0.22-4Dan Walsh 2.0.22-3Dan Walsh 2.0.22-2Dan Walsh 2.0.22-1Dan Walsh 2.0.21-2Dan Walsh 2.0.21-1Dan Walsh 2.0.20-1Dan Walsh 2.0.19-5Dan Walsh 2.0.19-4Dan Walsh 2.0.19-3Dan Walsh 2.0.19-2Dan Walsh 2.0.19-1Dan Walsh 2.0.16-2Dan Walsh 2.0.16-1Dan Walsh 2.0.15-1Dan Walsh 2.0.14-2Dan Walsh 2.0.14-1Dan Walsh 2.0.13-1Dan Walsh 2.0.10-2Dan Walsh 2.0.10-1Dan Walsh 2.0.9-10Dan Walsh 2.0.9-9Dan Walsh 2.0.9-8Dan Walsh 2.0.9-7Dan Walsh 2.0.9-6Dan Walsh 2.0.9-5Dan Walsh 2.0.9-4Dan Walsh 2.0.9-3Dan Walsh 2.0.9-2Dan Walsh 2.0.9-1Dan Walsh 2.0.8-1Dan Walsh 2.0.7-11Dan Walsh 2.0.7-10Dan Walsh 2.0.7-9Dan Walsh 2.0.7-8Dan Walsh 2.0.7-7Dan Walsh 2.0.7-6Dan Walsh 2.0.7-5Dan Walsh 2.0.7-4Dan Walsh 2.0.7-3Dan Walsh 2.0.7-2Dan Walsh 2.0.7-1Dan Walsh 2.0.6-3Dan Walsh 2.0.6-2Dan Walsh 2.0.6-1Dan Walsh 2.0.3-2Dan Walsh 2.0.3-1Dan Walsh 2.0.2-3Dan Walsh 2.0.2-2Dan Walsh 2.0.2-1Dan Walsh 2.0.1-2Dan Walsh 2.0.1-1Dan Walsh 2.0.0-1Dan Walsh 1.34.1-4Dan Walsh 1.34.1-3Dan Walsh 1.34.1-2Dan Walsh 1.34.1-1Dan Walsh 1.33.15-1Dan Walsh 1.33.14-1Dan Walsh 1.33.12-3Dan Walsh 1.33.12-2Dan Walsh 1.33.12-1Dan Walsh 1.33.11-1Dan Walsh 1.33.10-1Dan Walsh 1.33.8-2Dan Walsh 1.33.8-1Dan Walsh 1.33.7-1Dan Walsh 1.xXX L(;$;;;`[["@[ug@[`O@[CN@[:[0@ZZZ ZZ|;ZtRZs@Zp^@Z\ZX@Z - 10.32-3Petr Pisar - 10.32-2Petr Pisar - 10.32-1Petr Pisar - 10.31-11Petr Pisar - 10.31-10Petr Pisar - 10.31-9Petr Pisar - 10.31-8Petr Pisar - 10.31-7Petr Pisar - 10.31-6Petr Pisar - 10.31-5Petr Pisar - 10.31-4Petr Pisar - 10.31-3Petr Pisar - 10.31-2Petr Pisar - 10.31-1Fedora Release Engineering - 10.31-0.3.RC1.2Igor Gnatenko - 10.31-0.3.RC1.1Petr Pisar - 10.31-0.3.RC1Petr Pisar - 10.31-0.2.RC1Petr Pisar - 10.31-0.1.RC1Petr Pisar - 10.30-5Petr Pisar - 10.30-4Petr Pisar - 10.30-3Petr Pisar - 10.30-2Petr Pisar - 10.30-1Petr Pisar - 10.30-0.6.RC1Petr Pisar - 10.30-0.5.RC1Florian Weimer - 10.30-0.4.RC1Petr Pisar - 10.30-0.3.RC1Fedora Release Engineering - 10.30-0.2.RC1.1Petr Pisar - 10.30-0.2.RC1Petr Pisar - 10.30-0.1.RC1Petr Pisar - 10.23-8Petr Pisar - 10.23-7Petr Pisar - 10.23-6Petr Pisar - 10.23-5Petr Pisar - 10.23-4Petr Pisar - 10.23-3Petr Pisar - 10.23-2Petr Pisar - 10.23-1Fedora Release Engineering - 10.23-0.1.RC1.1Petr Pisar - 10.23-0.1.RC1Igor Gnatenko - 10.22-10.1Petr Pisar - 10.22-10Petr Pisar - 10.22-9Petr Pisar - 10.22-8Petr Pisar - 10.22-7Petr Pisar - 10.22-6Petr Pisar - 10.22-5Richard W.M. Jones <@redhat.com> - 10.22-4Petr Pisar - 10.22-3Petr Pisar - 10.22-2Petr Pisar - 10.22-1Petr Pisar - 10.22-0.1.RC1Petr Pisar - 10.21-6Petr Pisar - 10.21-5Petr Pisar - 10.21-4Petr Pisar - 10.21-3Petr Pisar - 10.21-2Fedora Release Engineering - 10.21-1.1Petr Pisar - 10.21-1Petr Pisar - 10.21-0.2.RC1Petr Pisar - 10.21-0.1.RC1Petr Pisar - 10.20-3Petr Pisar - 10.20-2Petr Pisar - 10.20-1Petr Pisar - 10.20-0.1.RC1Fedora Release Engineering - 10.10-3.1Marcin Juszkiewicz - 10.10-3Marcin Juszkiewicz - 10.10-2.1Petr Pisar - 10.10-2Petr Pisar - 10.10-1- Resolves: CVE-2022-1586- Fix CVE-2019-20454 (a crash when \X is used without UTF mode in a JIT) (bug #1734468)- 10.32 bump (bug #1628200) - Fix a subject buffer overread in JIT when UTF is disabled and \X or \R has a greater than 1 fixed quantifier (bug #1628200) - Fix matching a zero-repeated subroutine call at a start of a pattern (bug #1628200) - Fix heap limit checking overflow in pcre2_dfa_match() (bug #1628200)- Fix caseless matching an extended class in JIT mode (bug #1617960)- Fix anchoring in conditionals with only one branch (bug #1617960)- xІX& L(8jD$zjDiDWxj{xd   H(,HLV`w $x$ $ $ $  $  $ $D$$D/(n8x9l:6|GZ$H[$$I[$X\Y\ \\4$]\$^^|badcecfclc!tc<$uc$vd\we$xf0$yfggg"gdgxg|i2 iB jk!kdkh$kgkhkCfetchmail6.4.241.el8A remote mail retrieval and forwarding utilityFetchmail is a remote mail retrieval and forwarding utility intended for use over on-demand TCP/IP links, like SLIP or PPP connections. Fetchmail supports every remote-mail protocol currently in use on the Internet (POP2, POP3, RPOP, APOP, KPOP, all IMAPs, ESMTP ETRN, IPv6, and IPSEC) for retrieval. Then Fetchmail forwards the mail through SMTP so you can read it through your favorite mail client. Install fetchmail if you need to retrieve mail over SLIP or PPP connections.b]x64-builder01.almalinux.org$AlmaLinuxAlmaLinuxGPL+ and Public DomainAlmaLinux Packaging Team Applications/Internethttp://www.fetchmail.info/linuxx86_64]H] lbm IA`$,cU|p!3gG!ghW9R2`Y:e6m/AAA큤b]Kb]b]b]b]b]Kb]a?aaaa_uaa?ab]b]b]b]b]b]b]b]b]b]b]b]b]b]b]b]b]b]b]b]b]6736c2f3ea47899f138ff191e9f8e9c1a2c21262d98327d42262e1ce17dd9d15df3bfd8f314c625841a353cc35a2e10683ca23442b573dc3328d46c64fc615964af07f619128c721a3d54b484b85f99ce80f95551c4a40e877e2397f7a5c3431001d1b8d111a83e3bab8b4d511ea4767d37d3bd0583560fccece630df1ba8f3c4cc55b31f07d26066018e6ed1281a6ce29ac28acfe06bb93c0610ba671aad7bfe53df550e7934ce30cee05f7ae62ac57840cdef22e5e562bb23c5491e36a3a3d211bf8b5a8bb1d612fa4a1f47e3b0263de1ea5e3cb0f3e5b67a46651048704bb24e380bdaeb6c1f6c79eb4d4c135713e09c3d28dfa1ffe6f073d9165c4478cfcc596c574e5555853589b7378a7d452e78d4a481c918beb2559797b3819455a679455bea53c66cc86024d32aaf129a4258ad2a08eb6a156e609b4112eed92de64992e0f61c4092e6005ff4dfcaa1408ed822ce73cb679caf84b3a9dd417f075a47d66288df448fbaf6983c8a4b70d89416402dd4915a68440059d2f2e28302c77acde9d61494ca1f01504bccaf9a545b6012bf2ee8bb7d68296486a3899cfa11e03cb49cc1ccbbd01733712420d6b4f98e87a5609086c7816e63c4a2c77fae966d192cd5c7fc6cb53a584c970b249bc776ee572155f422af62813fe7f98d96649d1b349fa760cd1cac91a7a2f65dc143e49123cfc81f44fa889fba54c63ebd3e0f7624f7df14f084ebbf8b50b4cf04af11e39f47899941460ec63f25c64162aaf12ee7e45dfb58e2ef8e50e56fdf998aebe2288a59acee0b7b1fd97eb1958ce8f1daeccd3302dd44ccf7c0a148876a0881bb3ba0c5468e39d22af2dec161db14a958524f195e1e2e2a4b004a8dafbc2e8c5002ddde5c0535da1a1d723074d34d2dc0529bcf0badaca7d19d4cf573284b79f581fa5fa05aef25bfb2425a73d488a40a16f783c0345b5a416779f37ff3b57018a624d20274f38f35b9d72afc7a4e38b39d22166cb56f3761b6543d76c27f14f179e7f244e1058dfd770d33937887f3e4a5567847c84fbdec417c90e46591df4d3043a2396491401744b18a03e9a1db5b867790c93c27fe81cd2229538f98024b856bd9758578dee3869a2a49a358375df41f9bfdf8b8d919cba2c566e30fabcf604a96a29b4861bf01993c3106805b81917bdab90fba2c187fcc5582b6a61655787fda51270933f138fa0xHvXJLxjK${KKF4?d'- 9 p04 8N   $  <  l  8  D t  , \  } (89: (> @ %B -G T H I X Y Z [ \ ]  ^ b dWe\f_lat| u v8<B  (g,h0Ccpanel-php84-date-holidays-australia0.2.21.cp130~el8Driver based class to calculate holidays in Australia.Date_Holidays helps you calculate the dates and titles of holidays and other special celebrations. This is the driver for calculating holidays in Australia.hC{bh-centos-8.dev.cpanel.netBSDDevelopment/Librarieshttp://pear.php.net/package/Date_Holidays_Australialinuxnoarchecho /usr/local/cpanel/3rdparty/php/84/lib/pear/Date_Holidays_Australia.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place. if [ x$1 = x0 ]; then echo pear.php.net/Date_Holidays_Australia >> /var/cpanel/.pending_pear_deregistrations ; fiGjAAA큤AA큤RIhC{hC{hC{hC{hC{hC{hC{hC{hC{hC{hC{a69f2184d51f7a33ba7fad10f6ad941bd6f371cc027a41866069e2f1a3203e6efb106b1114148d1beda27eb66195bb1930e74cae98639fbc3988f1580782613cd3f2c11a02a2836964a2c0f2e6bcc6282b4a9e906d3e757bc18efddd6b068b64b1ae5df23154728977a71c05b1fd9f3a67cacd5356356bc6ffaec808b671154e54c38fc8ebee6d9d190e4fe83c6f4c4604a905cc65928bc4984d3c83f0cdc4c218ccc61ccb24ea8ef7adefe82e54f117b79135c519e7189b46b7cd6fe9a4eacce3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php84-date-holidays-australia-0.2.2-1.cp130~el8.src.rpmcpanel-php84-date-holidays-australia      /bin/sh/bin/shcpanel-php84cpanel-php84cpanel-php84cpanel-php84-date-holidaysrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)0.21.43.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3hAg$RIgNNHSloane Bernstein - 0.2.2-1.cp130~el8Andy Baugh - 0.2.2-2.cp118Todd Rinaldo - 0.2.2-1.cp118Todd Rinaldo - 0.2.0-1.cp118Todd Rinaldo - 0.2.1-1.cp118Todd Rinaldo - 0.1.0-1.cp118- Build for cPanel 130- Fix changelog generation- Bug #19177: TONS of test failures- Includes new Date_Holidays_AustraliaSA and Date_Holidays_AustraliaNSW drivers.- Bug #18878: Queen's Birthday in WA has moved in 2011- initial pear release/bin/sh/bin/shcpanel-php83-date-holidays-australia 0.2.2-1.cp130~el8Date_Holidays_Australia.xmlDateHolidaysDriverAustralia.phpAustraliaNSW.phpAustraliaQLD.phpAustraliaSA.pxeXLЇmI$}mIlI?d? d$ 0 $( -9NT\h n t  C HTcr(28< 9` : G lH xI X Y \ ,] 8^ Rb d e f !l #t <u Hv T p t z      PTXg\h`Ccpanel-perl-542-mail-sender0.9031.cp130~el8CPAN module - (DEPRECATED) module for sending mails with attachments through an SMTP serverCpanel build perl module 'Mail::Sender'(DEPRECATED) module for sending mails with attachments through an SMTP serverhbh-centos-8.dev.cpanel.netperlcpanel/perlhttps://metacpan.orglinuxnoarch}! $$$hX-¬X-¬416d3fa3781f09851be0df8d752394d121bacc63d5d22673ba282a58ca542e073c76119bc88bf7228e9c673f4660942e9473461bf0c48375692df800c88d643800a213877d122423cc730e7c890fa6f726bb0dd0ea1c69acf37f97fb6408819brootrootrootrootrootrootcpanel-perl-542-mail-sender-0.903-1.cp130~el8.src.rpmcpanel-perl(Mail::Sender)cpanel-perl(Mail::Sender::CType::Ext)cpanel-perl(Mail::Sender::CType::Win32)cpanel-perl(Mail::Sender::DBIO)cpanel-perl(Mail::Sender::IO)cpanel-perl-542-mail-sendercpanel-perl-542-mail-sender-ctype-extcpanel-perl-542-mail-sender-ctype-win32cpanel-perl-542-mail-sender-dbiocpanel-perl-542-mail-sender-iocpanel-perl-mail-sendercpanel-perl-mail-sender-ctype-extcpanel-perl-mail-sender-ctype-win32cpanel-perl-mail-sender-dbiocpanel-perl-mail-sender-io     cpanel-perl-542cpanel-perl-542-basecpanel-perl-542-carpcpanel-perl-542-encodecpanel-perl-542-exportercpanel-perl-542-file-basenamecpanel-perl-542-io-handlecpanel-perl-542-io-socket-inetcpanel-perl-542-mime-base64cpanel-perl-542-mime-quotedprintcpanel-perl-542-socketcpanel-perl-542-strictcpanel-perl-542-symbolcpanel-perl-542-tie-handlecpanel-perl-542-time-localcpanel-perl-542-warningsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.14.3h?b@`-@^8 @X@W@V<@S>Q+R@Busy Camels - 0.903-1.cp130Busy Camels - 0.903-1.cp108Busy Camels - 0.903-1.cp1198Todd Rinaldo - 0.903-1.cp1186Todd Rinaldo - 0.903-1.cp1162Todd Rinaldo - 0.902-1.cp1162Todd Rinaldo - v0.8.23-1.cp1156Todd Rinaldo - 0.8.22-1.cp1146Todd Rinaldo - 0.8.21-1.cp1136- Bump to 1.cp130 for re-build- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update patches: Mail-Sender 0.903- Update from upstream: Mail-Sender 0.903- Update from upstream: Mail-Sender 0.902- Update from upstream: Mail-Sender v0.8.23- Update from upstream: Mail-Sender 0.8.22- Update from upstream: Mail-Sender 0.8.210.9030.9030.9030.9030.9030.903-1.cp130~el80.9030.9030.9030.9030.9030.9030.9030.9030.903Sender.pmExt.pmWin32.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Mail//usr/local/cpanel/3rdparty/perl/542/cpanel-lib/Mail/Sender/CType/-O2 -g -pipe -Wall -Werror=format-secx(UX L8];$;;//usr/lib/.build-id/fb//usr/lib64//usr/share/doc//usr/share/doc/pcre2//usr/share/licenses//usr/share/licenses/pcre2/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fb6f8c4e86e8c48432f60eb77b33905491b2c5bf, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=da5dc4d9437e3807fc9d52d06ad610f194015d53, strippedASCII text PRRRRRRRRR PRRRRRRR utf-83c5dbdac688dfc01f92bfa2a82f2ebaf09177c03acc9d9d9c6a041a77b8638a4?@ȉ!<ΰQd~b Qd~5 $@E*d+t|K4P1殃K`}[u7ғk:h9ɶDw^ È\ ,v} 6_ AN n\k'}c+lgtJ\e.:Q[Ѳ2=EgBvuN&2١‘>Er[lt.o!A3E~\S8E}zI ùt:r3wߧ^m(K +'8 3i4lpXa/4egI7'Hv?5՗QJ3umz^- 0YƝJRom~Q43371934b469cfc08a10c736b490d484e8554613abbf56347a492af307961c581f614d4fdf0052eea3dc0082bfce46287a4c4ade2j{x+ |j{x cpanel-perl(Mail::SRS)th:D"cpanel-perl(Mail::SPF::v1::Record)rmICxcpanel-perl(Mail::SPF::Util)eBF"cpanel-perl(Mail::SPF::UnknownMod)Aecpanel-perl(Mail::SPF::Term)e@cpanel-perl(Mail::SPF::Server)SPF?i(cpanel-perl(Mail::SPF::SenderIPAddrMech)M>S)cpanel-perl(Mail::SPF::Result::TempError)=n(cpanel-perl(Mail::SPF::Result::SoftFail)e<:)cpanel-perl(Mail::SPF::Result::PermError);M$cpanel-perl(Mail::SPF::Result::Pass):e$cpanel-perl(Mail::SPF::Result::None)90cpanel-perl(Mail::SPF::Result::NeutralByDefault)8e'cpanel-perl(Mail::SPF::Result::Neutral)7e$cpanel-perl(Mail::SPF::Result::Fail)6c%cpanel-perl(Mail::SPF::Result::Error)5cpanel-perl(Mail::SPF::Result)cro4xcpanel-perl(Mail::SPF::Request)pe3Fcpanel-perl(Mail::SPF::Record)ane2:%cpanel-perl(Mail::SPF::PositionalMod)1:%cpanel-perl(Mail::SPF::Mod::Redirect)0: cpanel-perl(Mail::SPF::Mod::Exp)c/Mcpanel-perl(Mail::SPF::Mod)n).!cpanel-perl(Mail::SPF::Mech::PTR)- cpanel-perl(Mail::SPF::Mech::MX)F,o%cpanel-perl(Mail::SPF::Mech::Include)+e!cpanel-perl(Mail::SPF::Mech::IP6)*F!cpanel-perl(Mail::SPF::Mech::IP4)):$cpanel-perl(Mail::SPF::Mech::Exists)(e!cpanel-perl(Mail::SPF::Mech::All)'ecpanel-perl(Mail::SPF::Mech::A)t&cpanel-perl(Mail::SPF::Mech)i%o#cpanel-perl(Mail::SPF::MacroString)PF$u!cpanel-perl(Mail::SPF::GlobalMod)#r!cpanel-perl(Mail::SPF::Exception)"s-cpanel-perl(Mail::SPF::EUnexpectedTermObject)xDXL3$#342ts for mod_cgi/mod_cgid and the mpms they conflict with. HB-1153- Stop installing userdir.conf since it is broken and the functionality is handled elsewhere- Added /etc/apache2/bin directory for apache-specific utility scripts - Added additional macros to /etc/rpm/macros.apache2 so other rpms can make use of those paths- Added requirements for ea-cpanel-tools, scripting tools to work - with cPanel.- Disabled IPv4 Mapping- Added requirements for ea-apache24-mod_proxy and mod_proxy_http - so we can support proxy subdomains- Updated to version 2.4.16 via update_pkg.pl- Patched apxs so that it correctly handles the conf.modules.d arrangement- Added ea-apache24-config and ea-apache24-config-runtime as requirements for ea-apache24- Missing requirements for mod_session- Add ea-apache24-tools as a require for ea-apache24- Add ea-documentroot as a require for ea-apache24- Repair apxs craziness- Reference new locations of apr and apr-util packages- Fixed mpm conflicts - Removed itk conflict since apache shouldn't be concerned with that.. only itk should be - Removed unused cloudlinux cagefs patch- Added tmpfiles.d entry for c7- Added includes handler for .shtml files in cperror.conf- Added cperror.conf to handle error page configuration- Changed name of rpms generated to ea-apache24.- Added httpd.service file and installation for CentOS 7 machines- Added mime.types back into ea-apache24- Removed logrotate.d configuration to let WHM take care of this.- Split many modules out into their own packages - Set dependencies between packages where needed- Upgrade to 2.4.12 - Remove inappropriate or already-applied patches- Split the MPMs into their own packages - mod_heartbeat needs to be loaded after mod_status and mod_watchdog- Each module now has its own conf.modules.d file - conf.modules.d files are created programmatically - Simplified ssl, proxy_html, ldap, and session package file lists- Added cPanel-specific patches - Removed apache user creation, configured to run as nobody - Repaired incorrect run directories- Converted from CentOS 7, to CentOS 6- Remove index.html, add centos-noindex.tar.gz - update welcome.conf with proper aliases - change symlink for poweredby.png- mod_dav: add security fix for CVE-2013-6438 (#1077907) - mod_log_config: add security fix for CVE-2014-0098 (#1077907)- mod_ssl: improve DH temp key handling (#1057687)- mod_ssl: use 2048-bit RSA key with SHA-256 signature in dummy certificate (#1071276)- Mass rebuild 2014-01-24- mod_ssl: sanity-check use of "SSLCompression" (#1036666) - mod_proxy_http: fix brigade memory usage (#1040447)- rebuild- build with -O3 on ppc64 (#1051066)- mod_dav: fix locktoken handling (#1004046)- Mass rebuild 2013-12-27- use unambiguous httpd-mmn (#1029360)- mod_ssl: allow SSLEngine to override Listen-based default (#1023168)- systemd: Use {MAINPID} notation in service file (#969972)- systemd: send SIGWINCH signal without httpd -k in ExecStop (#969972)- expand macros in macros.httpd (#1011393)- fix "LDAPReferrals off" to really disable LDAP Referrals- revert fix for dumping vhosts twice- update to 2.4.6 - mod_ssl: use revised NPN API (r1487772)- mod_unique_id: replace use of hostname + pid with PRNG output (#976666) - apxs: mention -p option in manpage- add patch for aarch64 (Dennis Gilmore, #925558)- remove duplicate apxs man page from httpd-tools- remove zombie dbmmanage script- return 400 Bad Request on malformed Host header- htpasswd/htdbm: fix hash generation bug (#956344) - do not dump vhosts twice in httpd -S output (#928761) - mod_cache: fix potential crash caused by uninitialized variable (#954109)- execute systemctl reload as result of apachectl graceful - mod_ssl: ignore SNI hints unless required by config - mod_cache: forward-port CacheMaxExpire "hard" option - mod_ssl: fall back on another module's proxy hook if mod_ssl proxy is not configured.- fix service file to not send SIGTERM after ExecStop (#906321, #912288)- protect MIMEMagicFile with IfModule (#893949)- really package mod_auxo3XL@f$vfG{?uhd & ? '3KQX     - .03679t9 9 ; (;N8;X9;:AWGPHSXIUXVXYVd\V]X^g bhdjMejRfjUljWtjpulvo8wp4xrytuuu"uduxu|6w w6 yz!zdzh{g{h{ Cpython3.12-tkinter3.12.141.el8_10A GUI toolkit for PythonThe Tkinter (Tk interface) library is a graphical user interface toolkit for the Python programming language.jhx64-builder03.almalinux.org" AlmaLinuxAlmaLinuxPython-2.0.1AlmaLinux Packaging Team Unspecifiedhttps://www.python.org/linuxx86_64UnܨnpK T cccBBB?,q?XXQ^XX*x&*x D>Dcg d -|:[X-,;:<SGMS $   Z  64345    '&7'  }} ; q * 4 Q y_5AAA큤A큤A큤A큤큤큤큤큤큤jhOjhOjhOjgjgjgjg$jgj|{j|{jgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgj|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{jgj|{j|{jgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgjgj|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{j|{247307a5c4fea339d90c7fa369262fcdc8373666236453bc5242dba23dc1484349483ee35dded807413c4ec88079a086f9c9bb90a9a46ad441f80fcb6878c475247307a5c4fea339d90c7fa369262fcdc8373666236453bc5242dba23dc14843bbfb10f611d6adcaa70dcbc7d2875641d723f47efa81771b5bbd5d87a4b33f664648028778a32184f92ba0912b64d26f3aaf583644a12326f6081125bc20164d9738a6cb9cdd8139721dd82118bd527897db5325d807222883f70fb1c5a1c27ecc6fe07bcce37f4c4cefab284210c09deb213fd55f95e958209907952ebeaf7520e2c868855739f1066896c485c21dd35e83b7b408115db5671505ab252d46eb4c203aec9a95ff2df3f8622b09a0f5900d27d0bc088a49880b3e1f4d6a1676291261b7a1be7793104a7217a58a42b83343f970e8ede0bc44faa5ba8f1040f204a52d3a3c6c58c5d59d888d5503dbf331090321b449def199578d88e83cc593861261b7a1be7793104a7217a58axp#XX LNCaD$qaD`DbD08be087743653e08ef83b06be4c178cf287bc86e1583fe416b0bd126a37fb2ddaa77fd5ed9c33be4007d3634a4537ee1f569fe3673fcad9f645f541a06f702c2396a2abe1d09c5ee475717d57cb377abbb008f8bdfe35d38c4af8025f38da10a373b392012a475bcec1d769b5214de357dab245d994cc73262556eea6b2c7919924286c49ce058c74b93654d2630a3d2fadf9335bb467bc926e3006f775add71a2af8f8715d50e5753d7bd87fecc6fd99c6b1462043eea31da5db5625bd9c788dfd1846b753f522a7bce600bb758ff693daf63577caf8e11f6cf2c8921b284709a5278a208427977db8e85b9d20f57b804cf396c489fa4966aa2e247e9dcf1120e1d0e4e92efe0553d811f7a06995286676fc9a8fb51d0bfc3f630929e9ea738c0b186e0c48fb0a253276c7ff2640e1453320bcb4316c38852c135bcc6fa51d110916d3a8c3a51756d89dfd0a793307cdd633ca70347266966b9837bed96452ae9a9a60a53188e69d4437eee264f2ff06d883e64ad77b4839507fd3255aca6a308b5da2b360756152921a78628508f6905d9623abebd746ef7a3fffbf887edb70e4d982a4033c2647505e7eeba11efc3be7bbdaaa95233de89a06555b7373857e2dfdb0747d1a6683b51f792ed479e3cc18a5eeb7aa533ad206ac8536e161ea85560bacb3dfb02ab7d95253268d712a074f4c31b39cf53f982bd423eb049ddc3340437ed5fee81297c857261f4a1da00d4b3d6af4fa65c9379431e2327ef2d936fb2deb2194f2bab6e2b62764d1bd8aed8033b5553e351f40d5da76fd561b364ded4aefd926363382a682dabcfc0bc84c6bc130540e8de436a73fa257686fa870e6b527b1d389888ee5b16923bc0098986d69837b4561cc8a7ab098e6d924f6936f247daa4bf0891555cb1d581fa94303fe98eb830dde36174dd431bb48673867386d508ff9c75df17cee31d8cbd81161ae079cf5a681a4a58c924bae20689f150332f6dedcc079b5d40466135834ef727027509521b09ea7dc9b4baeeb6593b60ab006a250179660e5cea1e5a7fb3d26611bbc161de2d849374fda4161dd8828601127598eaa26364a1e0755d0345f7f21943eaf762491797b03a2f76a885e79b3706e00f99607ff3421d6ad4f1d69980ffe3fecb6c91a1a6755228abb1eabc8a25f50f2c1c9186a4249feb0076bfc3daeb77e49c35821ae1c378a90f2a165f4ed61a7b8a3549ef6c9e277054dde4936f0b4f7e0be0d2fbf618f33b5c7880790573d03204d62f4492991e7b066e9fb3eedb659e80aa7fb49781cd578400ca8ede3e9d90f7604e0303c283901f7879690da58e23677b4d56589dd0b11276f479f0bcaea4c648191c1f981ea1a7fda154271e2925ec8656140fad5e1504e4389af8d74b47d03c9538bb1bee8d40a585ce575ae160301b5d9c30c5cf9147b46530079f9e0363c168e055b60eb2c20d5e78633aeeb4f6e1d7b3aa9f11071e45341f285f41f2ce6f6746fca2a1f49efff10bdf3821488bc1835fb10cf21e1cfdfe1b6af29b3430caeac4ecd8465ec883cc1ba9f11c089f9829e66f9b434e69e8a62943d256503e85cd76918832df5c64e00efa48cc8b6021c47b01d0e004f7fb7c0b4566d925011d2672930767e7a16185279f9e47abfffb2a44dd468b9ff840ded6cebedb8ff94bdc5c6d5640fe5ea26cb23a739c0e2b6aa14209c77fbd3364e6f314c563b57bc322a5ee6b9f8bd193ebcfe1e64b0b35ff197d80cacc7881d92fcff08609be383b32af6d9febf89c2a51b3e5a148c86ac849057ecfc46da7c770d9a1a2061a4697dfd3f3c4617809d4e7416896e4ecf8b7542406c58b9ff6df8b98d0216c375cb200e9c6f5491e801ade78ed329827eb0821e4f7e67a422bbbfc3dcc98c72e5969565e91459b436b1416cb32bd14cc83c5f5ba9b06591327b315aadc4a198a18969f4f17eea3a62594e351480ad57eb18f68e46ec53d9f9f5dbafa472235082ee2e1efc7322580f6cca7e2f259fd8f123e50fd47a5cd55b79672fde9ec32631f8a2d14f290e4f4a9534a84df1398f942e9dc08c4a3fa95b32d931e680c74397f534655eb2ab37e5c566c1bd1e47cce35f646e621a5dba28a1bf4f89668baea401d8989cdad957a045a2b190a8a1459e4d9cec1b4d332030ee660d72ac34d77caeb936434aced5076bc17b2083f346a05dd13b3ebf44cbd4526064bd5ec48154343a133dbda8b7ca65f17d920a17376755778cc210342fd612015c9593fddc49ff7eabfcae1dbdeadee1f7ac024ef311250ef0ee6763689457f99faf9871dfd7663806675e81f025721133e20380f998c5c6dce07aea624baad997855cba6e389ca3c26fe05b1402d5b1bcfaef6c4d4703c9f5c0fc025774f53c7d19343e92c0d7f20a126d83bbaafd90017f974befa0c798270e46a8006067c60a4ecab8266c85703c7ef55039f71c032734a4dcfbb74cf2ef3b92c6eb08999238205f7a97adb9e70ba8a7150495d290c1ee27613732da355007ae58513c594bb2749f4eb532aa709fc067710b808c54c3d99541ddc572eead111daaa52933a981732461b6f57b5e0a70e0ec7cf30d39a0f35bdb81fb47b6f8d28479779c76ae0c172664cf36616752d689d295a332ddd66bb12a7f4ee9881e99993ef7f5582c96c47b08103f9fab646e8ead16f9939818662df4feb6dd6233fa3da346e4d7b7a28e556ad666ce1f560097f9180efce2dee2f351ad1d4d68fb71a0bec7bf9b55d0912ced3a13c42a5e0ee3671e0686684c5af1feb96d5c1fc05d37e3458daa7a8252a95e05fbf622a57f77201ccd9a167d04fcfxXHLؤ%T$$TTTlper name - helpers: Added kernel module - firewall.core.io.helper: Add module to helper - firewall-cmd: Removed duplicate --get-ipset-types from help output - firewall.core.fw_zone: Add zone bingings for PREROUTING in the raw table - firewall.core.ipXtables: Add PREROUTING default rules for zones in raw table - firewall-config: New support to handle helpers, new dialogs, new helper tab, .. - config/org.fedoraproject.FirewallConfig.gschema.xml.in: New show-helpers setting - firewall.client: New helper management for runtime and permanent configuration - firewall.server.firewalld: New runtime helper management, new nf_conntrack_helper property - firewall.server.config_service: Fix module name handling (no nf_conntrack_ prefix needed) - firewall.server.config: New permanent D-Bus helper management - New firewall.server.config_helper to provide the permanent D-Bus interface for helpers - firewall.core.fw_zone: Use helpers fw.nf_conntrack_helper for services using helpers - firewall.core.fw: New helper management, new _automatic_helpers and nf_conntrack_helper settings - firewall.core.fw_config: Add support for permanent helper handling - firewall.core.io.service: The module does not need to start with nf_conntrack_ anymore - firewall.functions: New functions to get and set nf_conntrack_helper kernel setting - firewall.core.io.firewalld_conf: New support for AutomaticHelpers setting - firewall.config.dbus: New D-Bus definitions for helpers, new DBUS_INTERFACE_REVISION 12 - New firewall.core.fw_helper providing FirewallHelper backend - New firewall.core.helper with HELPER_MAXNAMELEN definition - config/firewalld.conf: New AutomaticHelpers setting with description - firewall.config.__init__.py.in: New helpers variables - firewalld.spec: Add new helpers directory - config/Makefile.am: Install new helpers - New helper configuration files for amanda, ftp, irc, netbios-ns, pptp, sane, sip, snmp and tftp - firewall.core.io.helper: New IO handler for netfilter helpers - firewall.errors: New INVALID_HELPER error code - firewall.core.io.ifcfg: Use .bak for save files - firewall-config: Set internal log_denied setting after changing - firewall.server.config: Copy props before removing items - doc/xml/firewalld.ipset: Replaced icmptype name remains with ipset - firewall.core.fw_zone: Fix LOG rule placement for LogDenied - firewall.command: Use "source-ports" in print_zone_info - firewall.core.logger: Use syslog.openlog() and syslog.closelog() - firewall-[offline-]cmd man pages: Document --path-{zone,icmptype,ipset,service} - firewall-cmd: Enable --path-{zone,icmptype,service} options again - firewall.core.{ipXtables,ebtables}: Copy rule before extracting items in set_rules - firewall.core.fw: Do not abort transaction on failed ipv6_rpfilter rules - config/Makefile.am: Added cfengine, condor-collector and smtp-submission services - Makefile.am: New dist-check used in the archive target - src/Makefile.am: Reordered nobase_dist_python_DATA to be sorted - config/Makefile.am: New CONFIG_FILES variable to contain the config files - Merge pull request #150 from hspaans/master - Merge pull request #146 from canvon/bugfix/spelling - Merge pull request #145 from jcpunk/condor - Command line tools man pages: New section about sequence options and exit codes - Creating service file for SMTP-Submission. - Creating service file for CFEngine. - Fix typo in documentation: iptables mangle table - Only use sort on lists of main items, but not for item properties - firewall.core.io.io_object: import_config should not change ordering of lists - firewall.core.fw_transaction: Load helper modules in FirewallZoneTransaction - firewall.command: Fail with NOT_AUTHORIZED if authorization fails (RHBZ#1368549) - firewall.command: Fix sequence exit code with at least one succeeded item - Add condor collector service - firewall-cmd: Fixed --{get,set}-{description,short} for permanent zones - firewall.command: Do not use error code 254 for {ALREADY,NOT}_ENABLED sequences- Fix CVE-2016-5410: Firewall configuration can be modified by any loggexpX[LK$3KG_ado.pm_db.pm_odbc.pmcassandra.pmclickhouse.pmcockroach.pmcockroachdb.pmcouch.pmcouchdb.pmcubrid.pmdb.pmdb2.pmderby.pmexasol.pmfirebird.pmhive.pmimpala.pminformix.pmingres.pminterbase.pmldapdb.pmmaria.pmmariadb.pmmax.pmmaxdb.pmmonet.pmmonetdb.pmmongo.pmmongodb.pmmssql.pmmysql.pmoracle.pmpg.pmpgsql.pmpgxc.pmpostgres.pmpostgresql.pmpostgresxc.pmredshift.pmsnowflake.pmsqlite.pmsqlite3.pmsqlserver.pmsybase.pmteradata.pmunify.pmvertica.pmyugabyte.pmyugabytedb.pm/usr/local/cpanel/3rdparty/perl/542/cpanel-lib/URI/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2noarch-redhat-linux-gnuPerl5 module source textutf-806090a39b76f78716d436c3091059801da03a78c63cc94b5496c38d0e44baa82?M4i ئϣp/f669e341970f430b7316e2dae1d3c30f9bc35fdfcab413d968fd4ad2aa0ae8b1dcb371775f00243aaa220a4f57083b53d781a701j{quj{UQPublicKeyCredentialRpEntity.phpD_k%PublicKeyCredentialRequestOptions.php5!PublicKeyCredentialParameters.php PublicKeyCredentialOptions.php3QPublicKeyCredentialLoader.php PublicKeyCredentialEntity.phpNPurePerlPB!Me PureKill.ploPure.podc Pure.pm PN a Punycode.soe N n Punycode.pmetw wPunta_Arenas.pmew08Q`Q:qh Punta_Arenass,& F @PumpStream.php/,BdMdrPullParserToken.pmCL./+BcMcPullParserTextToken.pma/*BbMb.PullParserStartToken.pmeo/)BaMa-PullParserEndToken.pm0/( B`M` m PullParser.pmv vPuerto_Rico.pmRBG07Q`Q9qg Puerto_Ricored t Publish.pmC-xPublicTrait.phpQ M"O,uePublicSuffix.pm fQ+PublicKeyCredentialDescriptorCollection.phpz!PublicKeyCredentialDescriptor.phpi&PublicKeyCredentialCreationOptions.phpkPublicKeyCredential.php@..A o PublicKey.pmgQ  PublicKey.php Q4QQQ PublicKey+  PublicAPI.pod+ l PublicAPI.pm^ Public.pm8lPty.pmPPsr16Cache.phpPsr16Adapter.phpiWPsrP_PspellException.phpC^ P Pseudo.pm_ Pscript5IdiomPsException.phpdaB8M8QPs.plPruneableInterface.php$RPrune.pml,v CProxyWrite.phprProxyTrait.phpNBM ProxySubs.pm 1U1RProxyServer.pmR,u B ProxyRead.phpProxyHelper.php, ZProxyEnvironment.php6ProxyAdapter.phpR(BUB[Proxy.pm_H-{E{, Q{{`{  4 Proxy.phpxXLx@$P@A a6c415ebbc960d4a3ff473dd311187a250255cbbcd72?Pj#x~|tpkaeL9dԌ 2<0J(4?`TcͧbqxR!LD/= dAnĕyVxR&qŬs$+=ZªF`2EBSˤDy+KJ5SaXm\vjr-k8IjS3@z٠{!}L婾P$3oE, qt6v^}N_~"ߢ1ucZlr=ʣdU[|-Ő(hɻ 2sg_%:lҌ_cAL \$Z(фPM9hD8^jᶻg=eNPS\Bfx-uwdUDAc:==cbj!> O<n3"#C ,b~{vN6K$d1M5FzQ³W.uB%PZ2 S  Ǯ?ݛC<$4&e;v+<Ɣ<%1%Z 0)T] ̼ո6H˻D+xG] ?R?) .1쐊?uvq&Y6ikV~yxSxguRPi | ^c;ڇ(jvۺ:? ו 7:&,B(Pz8nnih!z_WBMasϰc,Nvr?8с4E*Q7[J=Bc- =vV pbB(ȻSWp»Jc[h|aN1f82:(X)bZ֑LeضOsf(^!]phE Ņ$ ZF_Ds?ғɛ/?j &4=΁{ :Cdl5lT[e6997870d6ddf2506c02b8a6aa2f9aa0e6ddf70a2d43b0f59546a18f5b78272cc9fce4ce47b118cd925d3ad9b85cf834d656c128j8 j8nerf's perf_evsel class (Michael Petlan) [1818835] - [tools] libperf: Adopt xyarray class from perf (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist__set_maps() function (Michael Petlan) [1818835] - [tools] libperf: Add threads to struct perf_evlist (Michael Petlan) [1818835] - [tools] libperf: Add cpus to struct perf_evlist (Michael Petlan) [1818835] - [tools] libperf: Add has_user_cpus to struct perf_evlist (Michael Petlan) [1818835] - [tools] libperf: Add threads to struct perf_evsel (Michael Petlan) [1818835] - [tools] libperf: Add own_cpus to struct perf_evsel (Michael Petlan) [1818835] - [tools] libperf: Add cpus to struct perf_evsel (Michael Petlan) [1818835] - [tools] libperf: Add perf_evsel__delete() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist__delete() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist__for_each_evsel() iterator (Michael Petlan) [1818835] - [tools] libperf: Add perf_evsel__new() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist__new() function (Michael Petlan) [1818835] - [tools] libperf: Move zalloc.o into libperf (Michael Petlan) [1818835] - [tools] libperf: Add perf_cpu_map__new()/perf_cpu_map__read() functions (Michael Petlan) [1818835] - [tools] libperf: Move perf_event_attr field from perf's evsel to libperf's perf_evsel (Michael Petlan) [1818835] - [tools] libperf: Add nr_entries to struct perf_evlist (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist__remove() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist__add() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist__init() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_evsel__init function (Michael Petlan) [1818835] - [tools] libperf: Include perf_evlist in evlist object (Michael Petlan) [1818835] - [tools] libperf: Include perf_evsel in evsel object (Michael Petlan) [1818835] - [tools] libperf: Add perf_evlist and perf_evsel structs (Michael Petlan) [1818835] - [tools] libperf: Add perf_thread_map__get()/perf_thread_map__put() (Michael Petlan) [1818835] - [tools] libperf: Add perf_thread_map__new_dummy() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_thread_map struct (Michael Petlan) [1818835] - [tools] libperf: Add perf_cpu_map__get()/perf_cpu_map__put() (Michael Petlan) [1818835] - [tools] libperf: Add perf_cpu_map__dummy_new() function (Michael Petlan) [1818835] - [tools] libperf: Add perf_cpu_map struct (Michael Petlan) [1818835] - [tools] libperf: Add debug output support (Michael Petlan) [1818835] - [tools] libperf: Add perf/core.h header (Michael Petlan) [1818835] - [tools] libperf: Add libperf to the python.so build (Michael Petlan) [1818835] - [tools] libperf: Add build vxXP6" \Ӕ